close all open/close all

CDS information : Medem_00200


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction19,612 / 20,334 / + [in whole cluster]
19,612 / 20,334 / + [in contig]
Location19612..20334 [in whole cluster]
19612..20334 [in contig]
TypeCDS
Length723 bp (240 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose N,N-dimethyltransferase
Product (GenBank)N-methyl transferase
Gene
Gene (GenBank)med-ORF15
EC number2.1.1.-
Keyword
  • angolosamine
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q9ZGH6
NITE
Pikro_00100
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[12119032] Expression, purification, and characterization of two N,N-dimethyltransferases, tylM1 and desVI, involved in the biosynthesis of mycaminose and desosamine. (Biochemistry. , 2002)

close this sectionSequence

selected fasta
>putative NDP-hexose N,N-dimethyltransferase [N-methyl transferase]
MYGNDSAELYDLLHSARGKDFDGEAAAVAALVDDRMPGAASLLDIACGTGAHLARFAERY
ERVEGVELSEPMLALARTRLPGVPFTLGDMRDFDLGRRFDAAVCLFGSIGYVDSADELDA
TLRSFARHLNPGGVLVVEPWWAPDTYTPGHVSADVVEADGTHVARVSHASLATPAGDASL
MRRSYVVAHADHGVRHFSEDHVCRLFGADRYEAAFTAAGFAFERVASPVSARGFLVGVRK
selected fasta
>putative NDP-hexose N,N-dimethyltransferase [N-methyl transferase]
ATGTACGGAAACGACTCCGCCGAGCTCTACGACCTCCTGCACAGCGCCCGGGGCAAGGAC
TTCGACGGCGAGGCCGCCGCGGTCGCCGCGCTCGTCGACGACCGCATGCCCGGCGCCGCC
TCCCTCCTCGACATCGCCTGCGGCACCGGCGCCCACCTCGCCCGCTTCGCCGAGCGGTAC
GAGCGCGTCGAGGGCGTGGAACTCTCCGAGCCCATGCTGGCCCTCGCCCGGACCCGGCTG
CCCGGCGTCCCGTTCACCCTCGGCGACATGCGCGACTTCGACCTGGGCCGCCGCTTCGAC
GCCGCGGTCTGCCTGTTCGGCTCCATCGGCTACGTCGACTCGGCCGACGAACTCGACGCC
ACCCTGCGCTCCTTCGCCCGCCACCTCAACCCCGGCGGCGTCCTGGTCGTGGAACCGTGG
TGGGCCCCGGACACCTACACCCCCGGGCACGTCTCCGCCGACGTGGTCGAGGCCGACGGA
ACGCACGTGGCCCGCGTCTCGCACGCCTCGCTCGCCACGCCCGCCGGCGACGCCTCCCTC
ATGCGCCGCTCCTACGTGGTGGCCCACGCCGACCACGGCGTAAGGCACTTCAGCGAGGAC
CACGTGTGCCGGCTCTTCGGCGCCGACCGGTACGAGGCCGCCTTCACCGCCGCGGGCTTC
GCCTTCGAGCGGGTCGCGAGCCCGGTGTCCGCCCGCGGGTTCCTCGTCGGGGTCCGCAAG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-43]  0.029 Signal
Eukaryota   
TMHMM No significant hit