close all open/close all

CDS information : Medem_00210


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction20,331 / 21,308 / + [in whole cluster]
20,331 / 21,308 / + [in contig]
Location20331..21308 [in whole cluster]
20331..21308 [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)NDP-4-keto-6-deoxyhexose reductase
Gene
Gene (GenBank)med-ORF14
EC number
Keyword
  • angolosamine
Note
Note (GenBank)
  • GTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-4-keto-6-deoxyhexose reductase]
MTAGPPTVPRTAPARRVMVLGGTGFVGRTVCADFRAAGWDVLAVARTAPERPAATRFLAL
DLAETPSATLARVLEAERPDVVVNATGSIWSRDDAAMERICTVPTLRLLDALATLRHRPR
LVHLGTVLEYGPLPPDGTPRPDPAPEPTTPYGRAKLAPSRAVLEAAASGAVRALVLRVSN
VSGVGAPDVSLLGRVAERLVTAPPAAGRSPSNSPRCGPTRHYVDVRDVSEAVLAAALSPA
SGRAVDIGRGEAVPVRWLVDLLVRVSGVPARIVERPAEPGAASERDWIRTDLAPAREVLG
WRPRRGLQESLAAYWADVSGRPAPV
selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-4-keto-6-deoxyhexose reductase]
GTGACGGCCGGACCGCCCACCGTCCCGCGGACCGCACCCGCCCGGCGCGTCATGGTGCTC
GGCGGCACGGGCTTCGTGGGGCGGACCGTCTGCGCGGACTTCCGCGCCGCCGGCTGGGAC
GTCCTGGCCGTGGCACGGACCGCGCCGGAGAGGCCCGCCGCGACCCGGTTCCTCGCCCTC
GACCTGGCGGAGACACCGTCGGCCACGCTCGCCCGCGTCCTGGAGGCCGAACGCCCCGAC
GTGGTCGTCAACGCCACCGGGAGCATCTGGAGCCGGGACGACGCCGCCATGGAACGCATC
TGCACCGTCCCCACCCTGCGGCTCCTCGACGCCCTCGCCACGCTGCGGCACCGGCCCCGT
CTCGTCCACCTCGGCACCGTGCTCGAGTACGGTCCGCTGCCGCCCGACGGCACCCCCCGC
CCCGACCCGGCACCCGAGCCGACCACCCCGTACGGAAGGGCGAAGCTCGCGCCGTCCCGC
GCCGTCCTGGAGGCGGCCGCGAGCGGCGCCGTGCGGGCCCTCGTCCTGCGCGTCTCGAAC
GTGTCGGGCGTCGGCGCCCCCGACGTCAGCCTGCTCGGCAGGGTCGCCGAGCGCCTGGTG
ACGGCTCCGCCGGCGGCGGGACGGTCACCGTCGAACTCGCCCCGCTGCGGGCCCACCCGG
CACTACGTCGACGTACGGGACGTGTCGGAGGCCGTGCTCGCGGCGGCGCTCTCGCCCGCC
AGCGGCCGGGCCGTCGACATCGGACGCGGCGAGGCCGTGCCCGTGCGGTGGCTCGTGGAC
CTCCTGGTGCGGGTGAGCGGGGTGCCCGCCCGGATCGTCGAACGGCCGGCGGAGCCCGGC
GCCGCCTCGGAGCGGGACTGGATCCGGACGGATCTCGCCCCGGCCCGTGAGGTCCTCGGC
TGGCGGCCGAGGCGCGGTCTGCAGGAGTCGCTCGCCGCCTACTGGGCGGACGTCAGCGGC
CGGCCCGCCCCCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [17-248]  2.1e-29 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [15-224]  9.9e-26 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-32]  0.541 Signal
Bacteria, Gram-positive   
 [1-31]  0.775 Signal
Eukaryota   
TMHMM No significant hit