close all open/close all

CDS information : Medem_00220


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction21,350 / 22,366 / + [in whole cluster]
21,350 / 22,366 / + [in contig]
Location21350..22366 [in whole cluster]
21350..22366 [in contig]
TypeCDS
Length1,017 bp (338 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative phosphotransferase
Product (GenBank)putative carbohydrate kinase
Gene
Gene (GenBank)med-ORF21
EC number
Keyword
Note
Note (GenBank)
  • GTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Family/Domain
FD
IPR011611, IPR002173

close this sectionSequence

selected fasta
>putative phosphotransferase [putative carbohydrate kinase]
MRIAVTGSIATDHLLTFPGRFGEQLIEGELDKVSLSFLADELDVRRGGVAANIAFGLGAL
GLRPLLVGSVGRDFAEYGRLLAAHGVDTGSVHVSETRHTARFICTTDADQNQIGTFYAGA
MSEARHIALAPVRDRAGGLDLVLVSPNDPEAMLRHTREAAALGVAFSADPSQQLARLGRD
EVRLLLRGPRHLFTNAYEAQLVQERTGWTERQVLERVGTWVITRGADGVRILASGRPAVD
VAAVPADGPVEPTGAGDAFRAGFLAATARADDPVRAARLGAALATTALESVGPQAYTLDG
APLLARIADAYGPEAAADLEPEVKAVRPAETAVGAEPS
selected fasta
>putative phosphotransferase [putative carbohydrate kinase]
GTGCGTATCGCGGTGACAGGCTCCATCGCCACCGACCATTTGCTGACGTTTCCCGGCCGG
TTCGGGGAGCAGCTCATCGAGGGCGAACTGGACAAGGTCTCGCTCTCGTTCCTCGCCGAC
GAGCTCGACGTGCGCCGGGGCGGTGTGGCGGCGAACATCGCCTTCGGCCTCGGCGCCCTC
GGACTGAGGCCCCTCCTCGTCGGGTCCGTCGGCAGGGACTTCGCCGAGTACGGGCGGCTG
CTCGCGGCACACGGGGTCGACACCGGCTCCGTCCACGTCAGCGAGACCCGGCACACGGCC
CGGTTCATCTGCACCACCGACGCGGACCAGAACCAGATCGGCACCTTCTACGCGGGCGCC
ATGAGCGAGGCACGGCACATCGCCCTCGCACCGGTGCGCGACCGCGCCGGGGGCCTCGAC
CTGGTGCTCGTCTCGCCGAACGACCCGGAGGCGATGCTGCGGCACACCAGGGAGGCCGCC
GCGCTCGGCGTCGCGTTCAGCGCCGACCCCTCCCAGCAGCTGGCGCGGCTCGGCAGGGAC
GAGGTCCGGCTGCTCCTGCGCGGGCCCCGCCACCTCTTCACCAACGCGTACGAGGCCCAG
CTCGTCCAGGAACGGACGGGGTGGACCGAGCGGCAGGTCCTGGAGCGGGTCGGCACCTGG
GTGATCACCCGGGGCGCGGACGGTGTCCGGATCCTGGCGTCCGGCCGGCCCGCCGTCGAC
GTGGCGGCCGTCCCCGCGGACGGGCCCGTGGAGCCCACCGGAGCCGGCGACGCCTTCCGG
GCCGGATTCCTCGCGGCCACGGCCCGCGCGGATGATCCGGTGCGGGCCGCCCGCCTCGGC
GCCGCCCTCGCCACCACGGCCCTGGAGTCCGTGGGGCCGCAGGCGTACACGCTCGACGGC
GCGCCGCTCCTCGCCCGCATCGCGGACGCGTACGGGCCCGAGGCCGCCGCCGACCTGGAG
CCGGAGGTCAAGGCCGTACGCCCGGCCGAAACGGCGGTCGGCGCCGAGCCCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002173 Carbohydrate/puine kinase, PfkB, conserved site (Conserved_site)
 [47-71]  PS00583
PS00583   PFKB_KINASES_1
IPR011611 PfkB (Domain)
 [34-295]  1e-39 PF00294
PF00294   PfkB
SignalP No significant hit
TMHMM No significant hit