close all open/close all

CDS information : Medem_00230


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction22,928 / 22,425 / - [in whole cluster]
22,928 / 22,425 / - [in contig]
Locationcomplement(22425..22928) [in whole cluster]
complement(22425..22928) [in contig]
TypeCDS
Length504 bp (167 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative NADH-dependent FMN reductase
Product (GenBank)NADH:FMN oxidoreductase
Gene
Gene (GenBank)med-ORF13
EC number1.5.1.42
Keyword
  • two-component system
  • C-6 quinone formation
Note
Note (GenBank)
  • GTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
P54994
PmId
[7665509] Cloning and analysis of structural genes from Streptomyces pristinaespiralis encoding enzymes involved in the conversion of pristinamycin IIB to pristinamycin IIA (PIIA): PIIA synthase and NADH:riboflavin 5'-phosphate oxidoreductase. (J Bacteriol. , 1995)
ACC
Q02058
NITE
Actino_00230
PmId
[7615536] Identification of a flavin:NADH oxidoreductase involved in the biosynthesis of actinorhodin. Purification and characterization of the recombinant enzyme. (J Biol Chem. , 1995)
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)

close this sectionSequence

selected fasta
>putative NADH-dependent FMN reductase [NADH:FMN oxidoreductase]
MTVRADIRSVRDADTFKDALSLLASPLTLVTTADEEGRPWGFTASSVTSASLSPPLVMVG
MARTSSCAAALDAASEFVVNVLGEQHEELARRFATRGIDRFAGQGLGAWPGTRLPFVPDA
HAAFRCAVEDRLRVGDHELLVGRPTEVLLDGGSRPLLWHRRGFRTAT
selected fasta
>putative NADH-dependent FMN reductase [NADH:FMN oxidoreductase]
GTGACCGTGCGCGCGGACATCAGGTCCGTACGCGACGCGGACACGTTCAAGGACGCGCTG
TCCCTGCTCGCCTCGCCGCTCACCCTCGTGACGACGGCGGACGAGGAGGGGCGTCCGTGG
GGGTTCACGGCGAGTTCGGTCACCTCCGCCTCGCTCTCTCCGCCGCTCGTCATGGTCGGC
ATGGCCCGCACCTCCAGTTGCGCCGCGGCGCTCGACGCCGCGTCCGAGTTCGTCGTCAAC
GTGCTCGGGGAGCAGCACGAGGAGCTGGCCCGCAGGTTCGCGACCCGGGGCATCGACCGG
TTCGCCGGTCAGGGGCTCGGCGCCTGGCCCGGGACCCGGCTGCCCTTCGTCCCCGACGCG
CACGCGGCGTTCCGCTGCGCGGTCGAGGACCGGTTGCGGGTCGGTGACCACGAGCTGCTC
GTCGGGCGCCCGACCGAGGTACTCCTCGACGGAGGTTCCCGGCCGCTGCTGTGGCACCGC
CGGGGGTTCCGTACGGCGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002563 Flavin reductase-like, FMN-binding (Domain)
 [22-165]  6.49999999999992e-36 PF01613
PF01613   Flavin_Reduct
 [20-165]  1.60000240695997e-49 SM00903
SM00903   Flavin_Reduct
IPR009002 FMN-binding split barrel-related (Domain)
 [8-166]  2.30000440726534e-48 SSF50475
SSF50475   FMN_binding
IPR012349 FMN-binding split barrel (Domain)
 [12-165]  4.39999999999997e-49 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP No significant hit
TMHMM No significant hit