close all open/close all

CDS information : Medem_00240


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction23,946 / 22,972 / - [in whole cluster]
23,946 / 22,972 / - [in contig]
Locationcomplement(22972..23946) [in whole cluster]
complement(22972..23946) [in contig]
TypeCDS
Length975 bp (324 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductC-3 ketoreductase
Product (GenBank)stereospecific keto reductase
Gene
Gene (GenBank)med-ORF12
EC number
Keyword
  • S-stereochemistry
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
[16169737] Functional studies on a ketoreductase gene from Streptomyces sp. AM-7161 to control the stereochemistry in medermycin biosynthesis. (Bioorg Med Chem. , 2005)
[22489461] [Expression detection of med-ORF12 encoding a stereochemical ketoreductase possibly involved in medermycin biosynthesis]. (Wei Sheng Wu Xue Bao. , 2012)

close this sectionSequence

selected fasta
>C-3 ketoreductase [stereospecific keto reductase]
MSGTGRPTVAVIGAGTIGLGWITLFLGHGLDVRVNSRRPEARSVVLEGLRTFVPTLPGGA
GLDPEELLERITFEPDVARAVEGVDVVQENAPEDLPLKQELYRLIGEAAPGRALLLSSTS
TLLPDAMGERMKDSGRLVVGHPFNSPHIVPLVEVVGGERTDPDAIARAVGFYRSVDRTPV
VLRRPIARFVANRLQSALLQESIHLVREGVVTMEELDTVVTRSIGLRWSTIGPFHSFHLG
GGEGGLRKWLGHLGVGLEKSWAELGSPRMTEETIDALGSEAERLFGGTTYAHLCRERDLR
HRAVLDALAAVEAERGEAEPGSAS
selected fasta
>C-3 ketoreductase [stereospecific keto reductase]
ATGAGCGGAACCGGCCGGCCCACCGTGGCGGTGATCGGCGCGGGGACGATCGGCCTCGGG
TGGATCACCCTGTTCCTCGGACACGGACTGGACGTGCGGGTGAACAGCCGCCGTCCCGAA
GCGCGGAGCGTCGTCCTGGAGGGCCTGCGGACCTTCGTGCCCACGCTGCCCGGCGGCGCC
GGACTCGACCCCGAGGAGCTCCTGGAACGGATCACCTTCGAGCCCGACGTGGCCCGCGCC
GTGGAGGGCGTCGACGTCGTCCAGGAGAACGCCCCGGAGGACCTGCCGCTCAAGCAGGAG
CTGTACCGCCTGATCGGCGAGGCCGCTCCGGGGCGGGCGCTGCTGCTGTCGTCGACCTCG
ACCCTGCTGCCCGACGCCATGGGCGAGCGGATGAAGGACTCCGGCCGTCTGGTCGTCGGG
CACCCCTTCAACTCCCCCCACATCGTTCCTCTGGTGGAGGTCGTCGGAGGCGAGCGGACG
GACCCGGACGCGATCGCGCGGGCGGTCGGCTTCTACCGCTCGGTGGACCGGACGCCCGTC
GTGCTGCGCCGGCCGATCGCCCGGTTCGTCGCGAACCGGCTGCAGTCCGCGCTGCTCCAG
GAGAGCATCCACCTCGTCCGTGAGGGCGTGGTGACGATGGAGGAGCTGGACACCGTCGTG
ACGCGGTCGATCGGCCTGCGGTGGTCCACGATCGGCCCGTTCCACTCCTTCCATCTCGGG
GGCGGGGAGGGCGGTCTGCGGAAGTGGCTGGGCCATCTCGGCGTCGGCCTCGAGAAGAGC
TGGGCCGAGCTCGGTTCGCCCCGGATGACCGAGGAGACGATCGACGCCCTCGGCTCGGAG
GCCGAACGTCTCTTCGGCGGGACCACGTACGCGCACCTGTGCCGGGAGCGCGACCTGCGG
CACCGCGCGGTGCTCGACGCGCTGGCGGCGGTCGAGGCGGAGCGCGGAGAAGCCGAGCCC
GGGAGCGCGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [189-247]  1e-11 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [8-183]  1.40000000000001e-41 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [188-249]  4.60000044330862e-09 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [190-243]  7.20000000000001e-09 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR016040 NAD(P)-binding domain (Domain)
 [8-189]  1.9e-37 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR022694 3-hydroxyacyl-CoA dehydrogenase (Family)
 [1-315]  2.69998997787809e-44 PIRSF000105
PIRSF000105   HCDH
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1