close all open/close all

CDS information : Medem_00250


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction24,129 / 24,905 / + [in whole cluster]
24,129 / 24,905 / + [in contig]
Location24129..24905 [in whole cluster]
24129..24905 [in contig]
TypeCDS
Length777 bp (258 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)pathway-specific transcriptional activator (SARP)
Gene
Gene (GenBank)med-ORF11
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • GTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
P46106
NITE
Actino_00160
PmId
[1878971] The act cluster contains regulatory and antibiotic export genes, direct targets for translational control by the bldA tRNA gene of Streptomyces. (Cell. , 1991)
[7683365] Stationary-phase production of the antibiotic actinorhodin in Streptomyces coelicolor A3(2) is transcriptionally regulated. (Mol Microbiol. , 1993)

close this sectionSequence

selected fasta
>putative transcriptional regulator [pathway-specific transcriptional activator (SARP)]
MKFHLLGPFEITTEDGRSCIPPTPKASQVLALLLSRPREIVPVDAFIQELWAENPPRSAL
TTLQTYIYHLRKILVGEGLAGTGERILVTRSPGYLIDPTGHGVDTREFEELVKSGRRAAD
RGHLELAARTLGDALDMWTGPALANISTGRVLTGYTMYLEELRVRAVEQRIEALKQLGNE
RDLIPELRALIQQYPLNEWFHAQLIESLNNCGRRAEALKVYRDLWRSLSDELGIEPSPDV
QGFHHEVLNPVARTVRAA
selected fasta
>putative transcriptional regulator [pathway-specific transcriptional activator (SARP)]
GTGAAATTCCATCTCCTCGGCCCCTTCGAGATCACCACGGAGGACGGCCGGTCGTGCATC
CCGCCCACCCCGAAGGCCAGTCAGGTCCTCGCCCTGCTGCTCTCCCGGCCCCGGGAGATC
GTGCCGGTCGACGCGTTCATCCAGGAACTCTGGGCCGAGAACCCCCCGCGCAGCGCCCTG
ACCACCCTGCAGACGTACATCTACCACCTGCGCAAGATCCTGGTCGGCGAGGGCCTCGCC
GGAACCGGGGAACGGATCCTCGTCACCCGCAGCCCCGGCTACCTCATCGACCCCACCGGA
CACGGCGTGGACACCCGGGAGTTCGAGGAGCTCGTGAAGTCCGGACGGCGGGCCGCCGAC
CGGGGCCACCTCGAACTGGCCGCCCGCACCCTGGGCGACGCCCTCGACATGTGGACCGGC
CCGGCCCTGGCCAACATCTCCACCGGCCGCGTCCTCACCGGCTACACCATGTACCTGGAG
GAGCTGCGGGTGCGCGCCGTCGAGCAGCGCATCGAGGCGCTCAAGCAGCTCGGGAACGAG
CGCGACCTCATCCCCGAACTGCGCGCGCTCATCCAGCAGTACCCGCTCAACGAGTGGTTC
CACGCCCAGCTCATCGAGTCGCTCAACAACTGCGGCCGGCGGGCCGAGGCCCTCAAGGTC
TACCGCGACCTGTGGCGCTCGCTCTCCGACGAACTGGGCATCGAGCCGTCGCCCGACGTG
CAAGGCTTCCATCACGAGGTACTGAACCCGGTCGCGCGGACCGTCCGCGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [18-95]  2.9e-16 PF00486
PF00486   Trans_reg_C
 [16-96]  1.20000117458134e-12 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [103-248]  6.99997659850661e-53 SM01043
SM01043   BTAD
 [103-248]  1.29999999999998e-50 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [108-223]  6.50000000000001e-05 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [23-97]  1.5e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-97]  1.89999859865864e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-40]  0.059 Signal
Bacteria, Gram-negative   
TMHMM No significant hit