close all open/close all

CDS information : Medem_00260


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction24,919 / 25,359 / + [in whole cluster]
24,919 / 25,359 / + [in contig]
Location24919..25359 [in whole cluster]
24919..25359 [in contig]
TypeCDS
Length441 bp (146 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown (ActVI-A homologue)
Gene
Gene (GenBank)med-ORF10
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
[26541165] Expression, Crystallization and Preliminary X-ray Diffraction Analyses of Med-ORF10 in the Biosynthetic Pathway of an Antitumor Antibiotic Medermycin. (Protein J. , 2015)
Related Reference
ACC
Q53925
NITE
Actino_00020
PmId
[17227452] Possible involvement of ActVI-ORFA in transcriptional regulation of actVI tailoring-step genes for actinorhodin biosynthesis. (FEMS Microbiol Lett. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [unknown (ActVI-A homologue)]
MSTHRVQGDLYSRVQQFHAAQMQALDSGRFDEYADTFTEDGEFRHSPGRPAAHTRAGIAK
ELAAFHQERFAGEPVQRRHWFNMLNVQEQADGTIHATFYVLALLTREGERVPEIAPSCLV
RDVLVEEDGRLLTRSRRVEHDHLPES
selected fasta
>hypothetical protein [unknown (ActVI-A homologue)]
ATGTCCACCCACCGAGTCCAGGGAGACCTGTACAGCCGGGTGCAGCAGTTCCACGCGGCG
CAGATGCAGGCGCTCGACAGCGGCCGGTTCGACGAGTACGCCGACACCTTCACCGAGGAC
GGCGAGTTCCGGCACTCGCCCGGCAGGCCGGCCGCCCACACCCGGGCCGGCATCGCCAAG
GAGCTCGCGGCGTTCCACCAGGAGCGCTTCGCCGGCGAACCCGTCCAGCGCCGCCACTGG
TTCAACATGCTGAACGTCCAGGAGCAGGCCGACGGCACCATCCACGCCACCTTCTACGTC
CTGGCGCTGCTGACCCGGGAGGGCGAGCGCGTCCCCGAGATCGCCCCCAGCTGCCTGGTC
CGGGACGTCCTCGTCGAGGAGGACGGCCGCCTCCTCACCCGCTCCCGCCGGGTGGAGCAC
GACCACCTGCCGGAATCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit