close all open/close all

CDS information : Medem_00270


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction25,400 / 26,419 / + [in whole cluster]
25,400 / 26,419 / + [in contig]
Location25400..26419 [in whole cluster]
25400..26419 [in contig]
TypeCDS
Length1,020 bp (339 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)enoyl reductase
Gene
Gene (GenBank)med-ORF9
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q53927
NITE
Actino_00040
PmId
[7929165] DNA sequence and functions of the actVI region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor A3(2). (J Biol Chem. , 1994)
[10805574] Chemical characterisation of disruptants of the Streptomyces coelicolor A3(2) actVI genes involved in actinorhodin biosynthesis. (J Antibiot (Tokyo). , 2000)
ACC
Q8KSX4
NITE
Griseo_00180
PmId
[19175308] Cleavage of four carbon-carbon bonds during biosynthesis of the griseorhodin a spiroketal pharmacophore. (J Am Chem Soc. , 2009)
ACC
Q59I44
PmId
[15781461] 2-Haloacrylate reductase, a novel enzyme of the medium chain dehydrogenase/reductase superfamily that catalyzes the reduction of a carbon-carbon double bond of unsaturated organohalogen compounds. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative oxidoreductase [enoyl reductase]
MPCALSESMSTAARMVRTEEVPIPEPGPGQVLIEAEAISVFAQTQMRRNVFPAPMWRPEF
PITLGGDVVGEVVAVGPGVTGNAPATGSAPSPWHGAYAEYVVVDADTVLPVPAALDAAQA
TALPAPGPIAMGTMGTASLAPGESVLVQRPSGGIGHLAVQLARLAGAGTVIATAGTPEKC
AYARSLGADVAVDYSRADWPDAVREATGGRGVDVILDSVGGDVLRQGVGLLAPFGRLVFY
GSAGGGLGIPAVSPMELIGMRFLTGFALSAWRNARPERYRADHDALTAHLLAGTVRQTVH
ATLPLEDVGKAHEIVESRAQLGRIVLLTGRGTRTAGGGA
selected fasta
>putative oxidoreductase [enoyl reductase]
ATGCCATGCGCGCTGTCCGAATCCATGAGTACGGCGGCCCGGATGGTGCGCACCGAAGAG
GTGCCGATACCGGAGCCAGGGCCCGGCCAGGTGCTGATCGAGGCCGAGGCGATCTCCGTG
TTCGCCCAGACCCAGATGCGGCGGAACGTCTTCCCCGCCCCCATGTGGCGCCCCGAGTTC
CCCATCACGCTCGGCGGGGACGTCGTCGGCGAGGTCGTCGCCGTGGGCCCCGGCGTCACC
GGCAACGCGCCCGCGACCGGGTCGGCGCCTTCACCCTGGCACGGCGCCTACGCCGAGTAC
GTCGTCGTCGACGCGGACACCGTCCTCCCGGTCCCCGCCGCCCTCGACGCGGCCCAGGCG
ACGGCGCTCCCCGCCCCCGGACCCATCGCCATGGGCACGATGGGCACGGCCTCCCTCGCC
CCCGGGGAGAGCGTCCTCGTGCAACGCCCCTCGGGCGGCATCGGACACCTCGCCGTCCAG
CTCGCCCGGCTCGCCGGGGCGGGGACGGTGATCGCCACCGCCGGCACGCCCGAGAAGTGC
GCCTACGCCCGCTCCCTCGGCGCGGACGTCGCCGTCGACTACAGCCGCGCGGACTGGCCG
GACGCCGTGCGCGAGGCCACCGGCGGCCGGGGCGTCGACGTGATCCTCGACAGCGTCGGC
GGTGACGTGCTCCGGCAGGGCGTGGGCCTCCTCGCCCCGTTCGGCCGGCTCGTCTTCTAC
GGTTCGGCCGGCGGCGGCCTCGGCATCCCCGCCGTCTCGCCGATGGAGCTCATCGGGATG
CGGTTCCTCACCGGATTCGCCCTCTCGGCCTGGCGGAACGCACGGCCCGAGCGGTACCGC
GCCGACCACGACGCGCTCACCGCCCACCTGCTCGCCGGCACCGTCCGCCAGACCGTGCAC
GCGACCCTGCCCCTGGAGGACGTCGGCAAGGCGCACGAGATCGTCGAGAGCCGGGCCCAG
CTGGGGCGCATCGTGCTCCTCACCGGCCGCGGCACCCGGACCGCGGGGGGTGGGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011032 GroES-like (Domain)
 [1-160]  6.79998707392904e-28 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [153-246]  1.9e-30 PF00107
PF00107   ADH_zinc_N
IPR016040 NAD(P)-binding domain (Domain)
 [147-246]  1.40000000000001e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit