close all open/close all

CDS information : Medem_00280


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction26,416 / 27,546 / + [in whole cluster]
26,416 / 27,546 / + [in contig]
Location26416..27546 [in whole cluster]
26416..27546 [in contig]
TypeCDS
Length1,131 bp (376 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative C-glycosyltransferase
Product (GenBank)C-glycosyl transferase
Gene
Gene (GenBank)med-ORF8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q9ZGC0
NITE
Lando_00200
PmId
[15977274] LanGT2 Catalyzes the First Glycosylation Step during landomycin A biosynthesis. (Chembiochem. , 2005)
[21513888] Rational design of an aryl-C-glycoside catalyst from a natural product O-glycosyltransferase. (Chem Biol. , 2011)
ACC
Q9RPA7
NITE
Urd_00200
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
[12696864] The C-Glycosyltransferase UrdGT2 is unselective toward d- and l-configured nucleotide-bound rhodinoses. (J Am Chem Soc. , 2003)
[17640665] Structure and action of the C-C bond-forming glycosyltransferase UrdGT2 involved in the biosynthesis of the antibiotic urdamycin. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>putative C-glycosyltransferase [C-glycosyl transferase]
MRILFVAGPSPATVFGLASLAVAARQAGHRVIVAGTEELVPHITGVGLPGAAVTPRTWES
LIVTDRSGGAVPRMPRGVEPERRHHGGWFGRLAAESLHGLRELAAHWRPGLVVGGSMSYA
APLLAAELGVPYVRQAWDLYDTRGVDPYAAEELRPELAALGLDRLPEPDLRVDVCPPSLR
PPDADPAQPMRWIPYNRQQELEPWMYGRGDRPRVCVTSGSRETEANRDFLGRLVADLAAF
DAEILVAAPEEAAARLRETAGRVRIGWMPLDVVAPTCDLLVHHGGGVTGMTALAAGTPQL
LLSRWDIFASTMRRTAERGAARVLFPEDTSPEAVLRACRELLEEPGPRKRSAEIAAEIAA
LPGPAEVVTALERLAA
selected fasta
>putative C-glycosyltransferase [C-glycosyl transferase]
ATGAGGATCCTCTTCGTCGCCGGCCCCAGCCCGGCGACCGTCTTCGGGCTCGCGTCCCTG
GCCGTCGCCGCACGTCAGGCGGGACACCGGGTGATCGTGGCCGGGACGGAGGAGCTCGTC
CCGCACATCACCGGCGTCGGCCTGCCCGGCGCGGCGGTCACGCCACGCACCTGGGAGAGC
CTGATCGTCACCGACCGGTCCGGCGGCGCGGTGCCCCGGATGCCCCGGGGCGTCGAGCCG
GAACGCCGCCACCACGGCGGCTGGTTCGGCCGGCTGGCCGCCGAGAGCCTGCACGGCCTG
CGCGAACTCGCCGCCCACTGGCGCCCCGGACTGGTCGTCGGCGGCAGCATGTCGTACGCG
GCCCCGCTGCTCGCGGCCGAGCTGGGCGTCCCGTACGTCCGCCAGGCCTGGGACCTGTAC
GACACCCGGGGGGTCGACCCGTACGCGGCGGAGGAGCTCCGCCCGGAGCTGGCCGCGCTG
GGGCTCGACCGGCTCCCCGAGCCGGACCTCCGGGTCGACGTCTGCCCGCCGAGCCTGCGG
CCCCCGGACGCCGACCCGGCGCAGCCGATGCGCTGGATCCCGTACAACCGGCAGCAGGAG
CTCGAACCGTGGATGTACGGCCGGGGCGACCGGCCCCGGGTGTGCGTGACCTCGGGCAGC
CGCGAGACGGAGGCCAACCGGGACTTCCTGGGCCGGCTGGTCGCGGACCTCGCCGCCTTC
GACGCGGAGATCCTCGTCGCCGCCCCGGAGGAGGCCGCGGCCCGGCTGCGGGAGACCGCC
GGGCGGGTACGGATCGGGTGGATGCCGCTCGACGTCGTCGCCCCGACCTGCGACCTCCTC
GTCCACCACGGCGGGGGAGTCACCGGGATGACCGCGCTCGCCGCCGGGACGCCCCAACTG
CTGCTGTCCCGCTGGGACATCTTCGCCTCGACCATGCGCCGCACGGCCGAGCGGGGTGCG
GCGCGGGTCCTCTTCCCCGAGGACACCTCGCCCGAGGCCGTGCTGCGGGCGTGCCGGGAG
CTCCTGGAGGAGCCCGGCCCCCGGAAGAGGTCCGCAGAGATCGCCGCCGAGATCGCCGCC
CTGCCCGGGCCGGCGGAGGTGGTCACGGCCCTGGAGCGGCTGGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-135]  1.1e-06 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [172-264]  1e-24 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.993 Signal
Bacteria, Gram-negative   
 [1-27]  0.98 Signal
Eukaryota   
 [1-24]  0.982 Signal
Bacteria, Gram-positive   
TMHMM No significant hit