close all open/close all

CDS information : Medem_00290


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction28,272 / 27,628 / - [in whole cluster]
28,272 / 27,628 / - [in contig]
Locationcomplement(27628..28272) [in whole cluster]
complement(27628..28272) [in contig]
TypeCDS
Length645 bp (214 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)pyran ring cyclase/possible exporter (ActVI-3 homologue)
Gene
Gene (GenBank)med-ORF5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q9ADD7
NITE
Actino_00050
PmId
[10805574] Chemical characterisation of disruptants of the Streptomyces coelicolor A3(2) actVI genes involved in actinorhodin biosynthesis. (J Antibiot (Tokyo). , 2000)
[12421300] Primary and secondary metabolism, and post-translational protein modifications, as portrayed by proteomic analysis of Streptomyces coelicolor. (Mol Microbiol. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [pyran ring cyclase/possible exporter (ActVI-3 homologue)]
MKKKSAAGIAAALSISAATAMLSVASPANATGPGTSTSSTVGYVCQSRYDGAWFPINGYS
RGFTTTAPAQVGKGVAFNVSFDPAPILAVGDYNKELTDIEVAYKVSPEARVLGYKLVGGS
NLGTARFHVERRGAEFVVTSPDTLPGGVEFDLPTLVVVRAPSTAGTVTTAPGGSSFENRS
FGWNRLHPANNQWDPFQCYANPATPVVFSTTNVA
selected fasta
>hypothetical protein [pyran ring cyclase/possible exporter (ActVI-3 homologue)]
ATGAAGAAGAAGAGCGCGGCGGGGATCGCCGCCGCCCTGAGCATCTCGGCGGCCACCGCA
ATGCTGAGCGTCGCGTCTCCGGCGAACGCCACCGGCCCGGGGACCAGCACCTCGTCGACC
GTCGGCTACGTGTGCCAGAGCCGCTACGACGGCGCGTGGTTCCCGATCAACGGGTACTCC
CGGGGCTTCACCACCACGGCTCCGGCGCAGGTCGGCAAGGGCGTCGCGTTCAACGTGTCG
TTCGACCCCGCGCCGATCCTGGCGGTGGGCGACTACAACAAGGAGCTCACCGACATCGAG
GTCGCCTACAAGGTGTCGCCCGAGGCCCGCGTCCTCGGCTACAAGCTGGTCGGCGGCAGC
AACCTCGGCACGGCCAGGTTCCACGTCGAACGCCGCGGCGCCGAGTTCGTCGTCACCTCG
CCCGACACCCTGCCCGGCGGCGTCGAGTTCGATCTGCCCACCCTCGTGGTCGTGCGCGCG
CCCTCCACCGCGGGCACGGTCACGACCGCCCCCGGCGGTTCGAGCTTCGAGAACCGCTCC
TTCGGCTGGAACCGTCTGCACCCGGCGAACAACCAGTGGGACCCGTTCCAGTGCTACGCC
AACCCGGCGACGCCGGTCGTGTTCAGCACGACGAACGTCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-30]  1 Signal
Bacteria, Gram-negative   
 [1-30]  1 Signal
Bacteria, Gram-positive   
 [1-30]  0.998 Signal
Eukaryota   
TMHMM No significant hit