close all open/close all

CDS information : Medem_00300


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction28,556 / 29,341 / + [in whole cluster]
28,556 / 29,341 / + [in contig]
Location28556..29341 [in whole cluster]
28556..29341 [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)keto reductase (KR)
Gene
Gene (GenBank)med-ORF6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
P16542
NITE
Grana_00250
PmId
[1400167] Functional replacement of genes for individual polyketide synthase components in Streptomyces coelicolor A3(2) by heterologous genes from a different polyketide pathway. (J Bacteriol. , 1992)
ACC
P16544
NITE
Actino_00170
PmId
[2394677] Biosynthesis of anthraquinones by interspecies cloning of actinorhodin biosynthesis genes in streptomycetes: clarification of actinorhodin gene functions. (J Bacteriol. , 1990)
[15458634] The crystal structure of the actIII actinorhodin polyketide reductase: proposed mechanism for ACP and polyketide binding. (Structure. , 2004)
[18205400] Inhibition kinetics and emodin cocrystal structure of a type II polyketide ketoreductase. (Biochemistry. , 2008)
[18691223] Localization of the ActIII actinorhodin polyketide ketoreductase to the cell wall. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [keto reductase (KR)]
MTQANGRVAVVTGATSGIGWEIAVRLAETGHRVYLCARSADRLAEAVKQLQDRGFDADGS
TCDVADPAQVTAFVTAAVARYGPIDVLVNNAGRSGGGITADVTDELWLDVVNTNLNSVFR
MTKAVLTVGGMQGKKRGRIVNIASTGGKQGVLHGAPYSASKHGVVGLTKAWGLELAKTGI
TVNAVCPGFVETPMAEKVRTHYAGIWGTTEEEAFERVTARVPIGRYVEPSEVAAMVDYLV
GDGAAAVTAQALNVCGGLGNY
selected fasta
>putative polyketide C-9 ketoreductase [keto reductase (KR)]
ATGACTCAGGCGAACGGCCGTGTGGCCGTGGTCACCGGCGCGACCAGCGGCATCGGATGG
GAGATCGCCGTCCGCCTGGCCGAGACCGGCCACCGGGTCTACCTCTGCGCGCGGTCGGCG
GACCGGCTGGCCGAGGCCGTCAAGCAGCTCCAGGACCGCGGCTTCGACGCCGACGGCAGC
ACCTGCGACGTCGCCGACCCCGCCCAGGTCACGGCCTTCGTCACGGCCGCCGTCGCCCGC
TACGGCCCCATCGACGTCCTGGTCAACAACGCCGGCCGCAGCGGCGGCGGCATCACCGCC
GACGTCACCGACGAGCTCTGGCTCGACGTCGTCAACACCAACCTCAACAGCGTCTTCCGG
ATGACGAAGGCGGTCCTCACCGTCGGCGGCATGCAGGGGAAGAAGCGCGGCCGCATCGTC
AACATCGCCTCCACCGGCGGCAAGCAGGGCGTCCTGCACGGCGCCCCCTACTCGGCCTCC
AAGCACGGCGTCGTCGGCCTGACGAAGGCCTGGGGCCTGGAGCTCGCCAAGACCGGCATC
ACCGTCAACGCCGTCTGCCCCGGCTTCGTCGAGACCCCCATGGCGGAGAAGGTCCGCACC
CACTACGCCGGGATCTGGGGGACCACGGAGGAGGAGGCCTTCGAGCGCGTCACCGCCCGG
GTGCCGATCGGCCGGTACGTCGAGCCCTCCGAGGTCGCCGCCATGGTCGATTACCTCGTC
GGCGACGGAGCCGCCGCGGTCACCGCCCAGGCCCTCAACGTCTGCGGCGGCCTCGGCAAC
TACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [82-93]  7.99999145876753e-13 PR00080 [137-145]  7.99999145876753e-13 PR00080 [157-176]  7.99999145876753e-13 PR00080
PR00080   SDRFAMILY
 [1-259]  7.79998304125571e-17 PIRSF000126
PIRSF000126   11-beta-HSD1
 [8-175]  4.2e-38 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  1.40000506907309e-44 PR00081 [82-93]  1.40000506907309e-44 PR00081 [131-147]  1.40000506907309e-44 PR00081 [157-176]  1.40000506907309e-44 PR00081 [178-195]  1.40000506907309e-44 PR00081 [222-242]  1.40000506907309e-44 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [3-258]  1.20000000000001e-81 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [144-172]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit