close all open/close all

CDS information : Medem_00310


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction29,375 / 30,514 / + [in whole cluster]
29,375 / 30,514 / + [in contig]
Location29375..30514 [in whole cluster]
29375..30514 [in contig]
TypeCDS
Length1,140 bp (379 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative FMNH2-dependent monooxygenase
Product (GenBank)oxygenase/hydroxylase
Gene
Gene (GenBank)med-ORF7
EC number
Keyword
  • two-component system
  • C-6 quinone formation
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
[23601640] Biosynthetic conclusions from the functional dissection of oxygenases for biosynthesis of actinorhodin and related streptomyces antibiotics. (Chem Biol. , 2013)
Related Reference
ACC
Q53907
NITE
Actino_00110
PmId
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)
[23601640] Biosynthetic conclusions from the functional dissection of oxygenases for biosynthesis of actinorhodin and related streptomyces antibiotics. (Chem Biol. , 2013)

close this sectionSequence

selected fasta
>putative FMNH2-dependent monooxygenase [oxygenase/hydroxylase]
MPATQPTSLSPDTVREAAETAAKHAAASEAERRLPPEVVDPILAAGFARHFVPARWGGSA
GTFGALLPAVTTIGESCTSAAWFASLAASVGRLAANLPTEGQAELWADGPDTPLVAALAA
AGTAERVPGGCPSAPVPYVSGVDSSAWPLVFARALDGDHQEPRFFAVPRAAYGLGDSWFN
VGLRATGSNTLVLDGVTVPDTRSVALAELLAGRAPEAEARCHRVPLKAANGLTLTAPLLG
AARGALRHWSGLVRGKLQAPAAAVTGAADRTPHELTLARTDGEVDAAALLLGRVAEVLDH
DAVDPLLTARNGRDCALAAELLAGAVDRLLRSSGSRGQADTEPLQRFWRDVNAGAGHSGL
QFPPVASALVRASRALDTP
selected fasta
>putative FMNH2-dependent monooxygenase [oxygenase/hydroxylase]
ATGCCTGCCACCCAGCCGACATCACTGTCCCCGGACACCGTGCGCGAGGCCGCCGAGACG
GCCGCCAAGCACGCGGCGGCCTCCGAGGCCGAGCGGAGACTGCCGCCCGAGGTCGTCGAC
CCGATCCTGGCCGCCGGCTTCGCCCGGCACTTCGTCCCGGCCCGCTGGGGCGGCTCGGCG
GGCACGTTCGGCGCCCTCCTGCCCGCCGTCACCACGATCGGCGAGAGCTGCACCTCGGCC
GCCTGGTTCGCCTCGCTCGCCGCGAGCGTCGGCCGCCTCGCCGCCAACCTCCCCACGGAG
GGCCAGGCGGAACTCTGGGCGGACGGGCCCGACACCCCGCTCGTCGCCGCCCTCGCGGCC
GCCGGCACCGCCGAACGCGTCCCCGGCGGGTGCCCGTCAGCGCCAGTGCCGTACGTCAGC
GGCGTCGACTCCTCCGCCTGGCCCCTGGTCTTCGCCAGGGCGCTCGACGGCGACCACCAG
GAGCCGCGCTTCTTCGCGGTGCCCCGCGCCGCGTACGGACTCGGGGACTCCTGGTTCAAC
GTCGGCCTGCGCGCCACCGGCAGCAACACCCTCGTCCTCGACGGCGTCACCGTGCCCGAC
ACGCGCTCCGTCGCCCTCGCCGAGCTGCTCGCCGGCCGGGCACCCGAAGCCGAGGCCCGC
TGCCACCGCGTCCCGTTGAAGGCCGCCAACGGCCTGACCCTCACGGCCCCCCTGCTCGGG
GCGGCCCGCGGCGCGCTGCGCCACTGGTCCGGCCTGGTGCGCGGCAAGCTCCAGGCACCG
GCCGCCGCCGTCACCGGCGCCGCGGACCGGACTCCCCACGAGCTCACGCTGGCCCGCACC
GACGGCGAGGTCGACGCGGCCGCCCTGCTGCTCGGCCGCGTGGCGGAGGTCCTCGACCAC
GACGCCGTGGACCCGCTCCTGACGGCCCGCAACGGACGCGACTGCGCGCTGGCGGCCGAG
CTGCTCGCCGGAGCCGTCGACCGGCTGCTGCGCTCCTCGGGCAGCAGGGGCCAGGCCGAC
ACCGAACCCCTCCAGCGGTTCTGGCGCGACGTCAACGCCGGGGCCGGCCACAGCGGCCTG
CAGTTCCCGCCCGTGGCGAGCGCGCTGGTCCGCGCCTCGCGGGCCCTCGACACCCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [120-197]  6.1e-13 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [12-104]  3.9e-05 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [198-365]  1.2e-28 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [232-359]  3.79999862644791e-06 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-206]  3.39999972437717e-22 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013107 Acyl-CoA dehydrogenase, type 2, C-terminal (Domain)
 [232-361]  1.09999999999999e-34 PF08028
PF08028   Acyl-CoA_dh_2
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [12-112]  5.09999999999998e-26 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit