close all open/close all

CDS information : Medem_00320


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction30,657 / 31,925 / + [in whole cluster]
30,657 / 31,925 / + [in contig]
Location30657..31925 [in whole cluster]
30657..31925 [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)ketosynthase (KS) alpha subunit
Gene
Gene (GenBank)med-ORF1
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
P16540
NITE
Grana_00260
PmId
[1400167] Functional replacement of genes for individual polyketide synthase components in Streptomyces coelicolor A3(2) by heterologous genes from a different polyketide pathway. (J Bacteriol. , 1992)
ACC
Q02059
NITE
Actino_00180
PmId
[10519556] A chain initiation factor common to both modular and aromatic polyketide synthases. (Nature. , 1999)
[10684659] Mechanistic analysis of a type II polyketide synthase. Role of conserved residues in the beta-ketoacyl synthase-chain length factor heterodimer. (Biochemistry. , 2000)
[15286722] An antibiotic factory caught in action. (Nat Struct Mol Biol. , 2004)
[18034463] Dissecting the component reactions catalyzed by the actinorhodin minimal polyketide synthase. (Biochemistry. , 2007)

close this sectionPKS/NRPS Module

KS3..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketosynthase (KS) alpha subunit]
MTRRVVVTGLGVRAPGGSGARQFWDLLSSGRTATRSITSFDASACRSQVAGEIDFDPVAE
GLSPREIRRMDRAAQFAVVCSREAVADSGLSFEGVRPERIGVSVGSAVAAAMSLEKEYRV
LSDQGREWEVDPTYLTPHMFDHMVPSVLGAEVAWTVGAEGPVTVVSDGCTSGLDSVGYAC
RLIQEGSVDVMLAGATDTPLTPIVAACFDAIKATTPRNDDAEHASRPFDLSRNGFVLAEG
AAMFVLEEYESAVRRGARIYAEVTGYATRLNAHHMTGLKTDGREMAEAIRVALDESRIDP
TAIDYVNAHGSGTKQNDRHETAAFKRSLGDHAYAVPVSSIKSMVGHSLGAIGSIEIAASL
LALTHQVVPPTANLHTADPECDLRYVPLTAREAPVRSVLTVGSGFGGFQSAMVLRRPEEA
AA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketosynthase (KS) alpha subunit]
ATGACCCGCCGTGTCGTCGTCACGGGCCTCGGGGTGCGTGCCCCGGGAGGCTCGGGGGCG
CGGCAGTTCTGGGACCTGCTCAGCTCCGGCCGCACCGCCACCCGCAGCATCACCTCCTTC
GACGCCTCCGCCTGCCGCTCCCAGGTGGCCGGCGAGATCGACTTCGACCCCGTCGCCGAA
GGCCTCTCCCCCCGCGAGATCCGCCGCATGGACCGGGCGGCACAGTTCGCCGTCGTCTGC
TCGCGCGAGGCCGTGGCCGACAGCGGCCTCTCCTTCGAGGGCGTCCGCCCCGAGCGGATC
GGTGTCAGCGTGGGCAGCGCGGTGGCGGCGGCCATGTCCCTGGAGAAGGAGTACCGGGTC
CTCTCCGACCAGGGCCGCGAATGGGAGGTCGACCCCACCTACCTGACCCCCCACATGTTC
GACCACATGGTGCCCAGCGTCCTCGGCGCCGAGGTCGCCTGGACCGTCGGCGCCGAGGGC
CCGGTCACCGTGGTCTCCGACGGCTGCACCTCCGGCCTCGACTCCGTGGGCTACGCCTGC
CGGCTGATCCAGGAGGGCTCGGTCGACGTCATGCTGGCCGGCGCCACCGACACCCCCCTC
ACCCCGATCGTCGCCGCGTGCTTCGACGCCATCAAGGCCACCACCCCGCGCAACGACGAC
GCCGAACACGCCTCGCGGCCCTTCGACCTGTCCCGCAACGGCTTCGTCCTCGCCGAGGGC
GCGGCGATGTTCGTCCTGGAGGAGTACGAGAGCGCGGTACGCCGCGGAGCCCGGATCTAC
GCCGAGGTGACCGGCTACGCGACCCGTCTCAACGCCCACCACATGACCGGGCTCAAGACC
GACGGCCGGGAGATGGCCGAGGCCATCCGCGTCGCCCTCGACGAGTCCAGGATCGACCCG
ACGGCCATCGACTACGTCAACGCCCACGGCTCGGGCACCAAGCAGAACGACCGCCACGAG
ACGGCCGCCTTCAAGCGGAGCCTCGGCGACCACGCCTACGCCGTGCCCGTCAGCTCCATC
AAGTCGATGGTCGGCCACTCGCTCGGCGCCATCGGCTCCATCGAGATCGCGGCGAGCCTC
CTGGCCCTGACGCACCAGGTCGTCCCGCCCACGGCCAACCTCCACACCGCCGACCCGGAG
TGCGACCTTCGATACGTCCCGCTGACCGCCCGCGAGGCACCGGTGCGCAGCGTCCTCACG
GTGGGCAGCGGCTTCGGCGGATTCCAGTCCGCGATGGTGCTCCGACGGCCCGAGGAGGCG
GCGGCATGA
KS3..375
KS7..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-251]  6.49999999999992e-60 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-375]  6e-37 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-263]  8.49999999999995e-67 G3DSA:3.40.47.10 [271-418]  5.19999999999996e-52 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-257]  3.30001976117415e-69 SSF53901 [219-418]  1e-63 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-20]  0.705 Signal
Eukaryota   
TMHMM No significant hit