close all open/close all

CDS information : Medem_00340


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction33,141 / 34,049 / + [in whole cluster]
33,141 / 34,049 / + [in contig]
Location33141..34049 [in whole cluster]
33141..34049 [in contig]
TypeCDS
Length909 bp (302 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)second ring cyclase (CYC)
Gene
Gene (GenBank)med-ORF3
EC number
Keyword
  • 2nd ring
Note
Note (GenBank)
  • GTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q9X466
NITE
Naphcy_00060
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)
ACC
Q93IZ0
NITE
Actino_00220
PmId
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [second ring cyclase (CYC)]
MADDTSRLVEVADGVHAYVQPDGGWCLNNAGVILAGDEAIVVDTAATERRALRLKESVDS
LAAGPRRTVVNTHFHGDHTFGNNVFGPDATVVSHALTRTDMAETGLALTGLWPDVEWGDV
EVVLPDLTYSGSLTLHADGRRVDLLHLGPAHTRSDTVVWLPEERVLFTGDIVMPGCTPFV
LMGTVRGSLEVLQRLRALEPVTVVGGHGPLAGPEAFDATEEYLRWLEKVAAEGAARGLTP
LEAARTCDLGPFAGLLDSERLVGNLHRAWHERDDPRLASPLDVVGVFGEMVTYHGRLPDC
HA
selected fasta
>putative cyclase/dehydratase [second ring cyclase (CYC)]
GTGGCTGACGACACCTCGCGGCTCGTCGAGGTCGCCGACGGGGTCCACGCGTACGTGCAG
CCCGACGGAGGCTGGTGCCTGAACAACGCGGGCGTGATCCTCGCCGGCGACGAGGCGATC
GTCGTCGACACGGCCGCCACCGAACGCCGTGCGCTGCGGCTGAAGGAGAGCGTCGACTCC
CTCGCGGCAGGTCCGCGGCGCACGGTGGTCAACACCCACTTCCACGGCGACCACACCTTC
GGCAACAATGTCTTCGGGCCGGACGCCACCGTCGTCAGCCACGCCCTCACCCGGACCGAC
ATGGCCGAGACCGGGCTGGCGCTGACCGGCCTCTGGCCGGACGTCGAGTGGGGGGACGTG
GAGGTCGTCCTGCCCGACCTCACGTACTCCGGAAGCCTGACCCTGCACGCCGACGGCCGG
CGCGTGGACCTGCTGCACCTCGGCCCCGCGCACACGCGCAGCGACACCGTGGTCTGGCTG
CCGGAGGAACGGGTCCTGTTCACCGGGGACATCGTGATGCCCGGCTGCACGCCGTTCGTC
CTCATGGGGACGGTACGGGGCTCCCTGGAGGTCCTGCAGCGGCTGCGCGCGCTGGAGCCG
GTCACGGTCGTGGGCGGCCACGGACCGCTCGCCGGCCCCGAGGCCTTCGACGCCACCGAG
GAGTACCTGCGGTGGCTGGAGAAGGTCGCGGCCGAGGGCGCCGCGCGCGGGCTCACCCCG
CTGGAGGCGGCCAGGACGTGCGACCTGGGCCCCTTCGCCGGACTGCTCGACTCCGAGCGG
CTCGTCGGCAACCTGCACCGCGCCTGGCACGAACGGGACGATCCCCGGTTGGCGAGCCCC
CTGGACGTCGTCGGGGTGTTCGGCGAGATGGTGACGTACCACGGCCGTCTTCCCGACTGC
CACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [27-207]  1.60000240695997e-30 SM00849
SM00849   Lactamase_B
 [24-207]  3.90000000000001e-19 PF00753
PF00753   Lactamase_B
SignalP
 [1-35]  0.036 Signal
Eukaryota   
TMHMM No significant hit