close all open/close all

CDS information : Medem_00350


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction35,374 / 34,145 / - [in whole cluster]
35,374 / 34,145 / - [in contig]
Locationcomplement(34145..35374) [in whole cluster]
complement(34145..35374) [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative secreted chitosanase
Gene
Gene (GenBank)med-ORF4
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in medermycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)

close this sectionSequence

selected fasta
>[putative secreted chitosanase]
MPPTINGCAAAASRPSSPPRPPASCSPPLAGLTSATAAAVNLAANRPVTTSSTESGSFGG
AKAVAGSASTRWASAEGVDNQWIRIDLGSATTLGRVVLKWEAAYARAYRVELSDDGSTWR
QIHATTTGDGGTDDLSVNGTGRYLRVFGTQRGTPYGYSLYEVEAYGAGATTPPPSSGTGL
DDPRKKEVAMKLVSSFENSSLDWRAQFAYIEDIDDGRGYTAGIIGFCSGTGDMLELVERY
TAKKPGNPLARYLGALRAVDGTDSHEGLDPGFTNAWRQAAQDTVFQQTQEEERDRVYFTP
AVSQAKQDGLRALGQFAYYDAAVMHGESGFRDIRSVALSRALPPSRGGDEKAYLKAFLDA
REEEMRKEEAHSDTTRVSTAQRRFLNEGNLDLNTPLHWSVYGEAFSLTG
selected fasta
>[putative secreted chitosanase]
ATGCCCCCCACGATCAACGGCTGCGCGGCCGCCGCCTCGCGGCCCTCGTCGCCGCCGCGG
CCACCGGCGTCCTGCTCCCCACCCCTGGCCGGCCTCACGTCCGCCACCGCCGCGGCCGTC
AACCTCGCCGCGAACCGCCCCGTCACCACCTCCTCCACCGAGTCCGGCTCGTTCGGCGGC
GCCAAGGCCGTGGCAGGCTCCGCCTCCACCCGCTGGGCAAGCGCCGAAGGCGTCGACAAC
CAGTGGATCCGGATAGACCTCGGCTCGGCGACGACCCTCGGCCGGGTCGTCCTCAAGTGG
GAGGCGGCCTATGCCAGGGCGTACCGCGTCGAGCTCTCGGACGACGGCTCGACCTGGCGC
CAGATCCACGCCACCACCACCGGCGACGGCGGCACCGACGACCTGAGCGTGAACGGAACC
GGCCGCTACCTCCGCGTCTTCGGGACGCAGCGCGGCACGCCGTACGGCTACTCGCTCTAC
GAGGTCGAGGCGTACGGCGCGGGCGCGACGACCCCGCCCCCGTCCTCCGGCACCGGCCTC
GACGACCCGCGCAAGAAGGAGGTCGCCATGAAGCTGGTGTCGTCCTTCGAGAACTCCTCC
CTCGACTGGCGCGCCCAGTTCGCGTACATCGAGGACATCGACGACGGGCGCGGCTACACC
GCCGGCATCATCGGCTTCTGCTCGGGCACGGGTGACATGCTGGAGCTGGTCGAGCGCTAC
ACGGCGAAGAAGCCGGGCAACCCGCTCGCCCGCTACCTCGGCGCCCTGCGCGCGGTGGAC
GGCACCGACTCCCACGAGGGCCTGGACCCGGGCTTCACGAACGCCTGGCGCCAGGCGGCG
CAGGACACCGTGTTCCAGCAGACCCAGGAGGAGGAGCGCGACCGCGTCTACTTCACTCCC
GCGGTCTCCCAGGCCAAGCAGGACGGCCTGCGCGCGCTGGGGCAGTTCGCCTACTACGAC
GCCGCCGTCATGCACGGCGAGTCCGGCTTCCGCGACATCCGCTCGGTCGCCCTCTCCCGC
GCCCTGCCGCCGTCCCGGGGCGGAGACGAGAAGGCCTATCTGAAGGCCTTCCTCGACGCG
CGTGAGGAGGAGATGCGCAAGGAGGAGGCGCACAGCGACACCACCCGGGTCAGCACGGCC
CAGCGCCGCTTCCTGAACGAGGGCAACCTCGACCTGAACACCCCGCTCCACTGGAGCGTC
TACGGCGAGGCCTTCTCCCTCACCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000400 Glycoside hydrolase, family 46 (Family)
 [190-396]  2.99999999999998e-65 PF01374
PF01374   Glyco_hydro_46
IPR000421 Coagulation factor 5/8 C-terminal type domain (Domain)
 [39-167]  0.000429999934584839 SM00231
SM00231   FA58C
 [48-162]  2.1e-22 PF00754
PF00754   F5_F8_type_C
 [25-167]  PS50022
PS50022   FA58C_3
IPR008979 Galactose-binding domain-like (Domain)
 [25-169]  7.40000780398342e-30 SSF49785
SSF49785   Gal_bind_like
IPR023099 Glycoside hydrolase, family 46, N-terminal (Domain)
 [169-285]  2.8e-54 G3DSA:3.30.386.10
G3DSA:3.30.386.10   Glyco_hydro_46_N
IPR023346 Lysozyme-like domain (Domain)
 [176-409]  4.80002938964646e-92 SSF53955
SSF53955   SSF53955
SignalP
 [1-39]  0.534 Signal
Bacteria, Gram-negative   
 [1-43]  0.776 Signal
Eukaryota   
 [1-37]  0.669 Signal
Bacteria, Gram-positive   
TMHMM No significant hit