close all open/close all
Medem_00350 Medem_00350   last last

CDS information : Medem_00360


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction36,201 / 35,704 / - [in whole cluster]
36,201 / 35,704 / - [in contig]
Locationcomplement(35704..36201) [in whole cluster]
complement(35704..36201) [in contig]
TypeCDS
Length498 bp (165 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative regulatory protein
Gene
Gene (GenBank)ORF Z
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in medermycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)

close this sectionSequence

selected fasta
>[putative regulatory protein]
MALPKSFRAGRVWLPSLGVCAVEPLPGGWLMRVEEEARPEEPGAEAASRVVLDLSRPRRW
TVAVSGVAGCWQQELSPRHAELLYVLALHRDGRTAAELADDVFGDRTRTVTVRAEMSRVR
RNLAGVLAHRPYRFREEVAVEVLRPERPADLLPHSTAPAVRAGRA
selected fasta
>[putative regulatory protein]
ATCGCGCTGCCCAAGTCGTTCCGGGCCGGCCGGGTCTGGCTGCCCTCGCTGGGCGTGTGC
GCGGTGGAACCGCTGCCGGGCGGCTGGCTGATGCGGGTCGAGGAGGAGGCTCGGCCCGAG
GAGCCGGGCGCGGAGGCGGCGAGCCGGGTGGTCCTGGACCTGAGCAGGCCGCGCCGCTGG
ACGGTGGCGGTCTCGGGGGTGGCGGGCTGCTGGCAGCAGGAGCTGAGCCCCCGTCACGCG
GAGCTCCTGTACGTCCTGGCGCTGCACCGCGACGGGCGGACGGCGGCGGAACTGGCGGAC
GACGTCTTCGGGGACCGTACGCGGACGGTGACGGTGCGGGCGGAGATGTCCCGGGTGCGG
CGGAACCTGGCGGGGGTCCTGGCGCACCGCCCGTACCGCTTCCGCGAGGAGGTCGCGGTG
GAGGTCCTGCGCCCGGAGCGCCCCGCGGACCTGCTCCCCCACTCGACGGCCCCGGCGGTC
CGGGCGGGCCGGGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-21]  0.371 Signal
Bacteria, Gram-positive   
 [1-21]  0.388 Signal
Bacteria, Gram-negative   
 [1-24]  0.909 Signal
Eukaryota   
TMHMM No significant hit
Medem_00350 Medem_00350   last last