close all open/close all
first first   Megalo_00020 Megalo_00020

CDS information : Megalo_00010


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction144 / 1 / - [in whole cluster]
144 / 1 / - [in contig]
Locationcomplement(1..144) [in whole cluster]
complement(1..144) [in contig]
TypeCDS
Length144 bp (47 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase(fragment)
Product (GenBank)TDP-4-keto-6-deoxyglucose-2,3-dehydratase
GenemegBVI
Gene (GenBank)megT
EC number
Keyword
  • megosamine
  • mycarose
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[15870344] Production of the potent antibacterial polyketide erythromycin C in Escherichia coli. (Appl Environ Microbiol. , 2005)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase(fragment) [TDP-4-keto-6-deoxyglucose-2,3-dehydratase]
MGDRVNGHATPESTQSAIRFLTRHGGPPTATDDVHDWLAHRAAEHRLE
selected fasta
>dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase(fragment) [TDP-4-keto-6-deoxyglucose-2,3-dehydratase]
ATGGGGGATCGGGTCAACGGTCATGCGACTCCGGAATCCACACAATCGGCAATACGTTTC
CTGACTCGGCACGGCGGACCTCCCACCGCCACCGACGACGTCCACGACTGGTTGGCCCAC
CGCGCCGCCGAGCATCGGCTCGAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit
first first   Megalo_00020 Megalo_00020