close all open/close all

CDS information : Megalo_00020


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction928 / 2,061 / + [in whole cluster]
928 / 2,061 / + [in contig]
Location928..2061 [in whole cluster]
928..2061 [in contig]
TypeCDS
Length1,134 bp (377 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase helper protein
Product (GenBank)TDP-4-keto-6-deoxyhexose 3,4-isomerase
Gene
Gene (GenBank)megDVI
EC number
Keyword
  • megosamine
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>glycosyltransferase helper protein [TDP-4-keto-6-deoxyhexose 3,4-isomerase]
MAVGDRRRLGRELQMARGLYWGFGANGDLYSMLLSGRDDDPWTWYERLRAAGRGPYASRA
GTWVVGDHRTAAEVLADPGFTHGPPDAARWMQVAHCPAASWAGPFREFYARTEDAASVTV
DADWLQQRCARLVTELGSRFDLVNDFAREVPVLALGTAPALKGVDPDRLRSWTSATRVCL
DAQVSPQQLAVTEQALTALDEIDAVTGGRDAAVLVGVVAELAANTVGNAVLAVTELPELA
ARLADDPETATRVVTEVSRTSPGVHLERRTAASDRRVGGVDVPTGGEVTVVVAAANRDPE
VFTDPDRFDVDRGGDAEILSSRPGSPRTDLDALVATLATAALRAAAPVLPRLSRSGPVIR
RRRSPVARGLSRCPVEL
selected fasta
>glycosyltransferase helper protein [TDP-4-keto-6-deoxyhexose 3,4-isomerase]
ATGGCAGTTGGCGATCGAAGGCGGCTGGGCCGGGAGTTGCAGATGGCCCGGGGTCTCTAC
TGGGGGTTCGGTGCCAACGGCGATCTGTACTCGATGCTCCTGTCCGGACGGGACGACGAC
CCCTGGACCTGGTACGAACGGTTGCGGGCCGCCGGACGGGGACCGTACGCCAGTCGGGCC
GGAACGTGGGTGGTCGGTGACCACCGGACCGCCGCCGAGGTGCTCGCCGATCCGGGCTTC
ACCCACGGCCCGCCCGACGCTGCCCGGTGGATGCAGGTGGCCCACTGCCCGGCGGCCTCC
TGGGCCGGCCCCTTCCGGGAGTTCTACGCCCGCACCGAGGACGCGGCGTCGGTGACAGTG
GACGCCGACTGGCTCCAGCAGCGGTGCGCCAGGCTGGTGACCGAGCTGGGGTCGCGCTTC
GATCTCGTGAACGACTTCGCCCGGGAGGTCCCGGTGCTGGCGCTCGGTACCGCGCCCGCA
CTCAAGGGCGTGGACCCCGACCGTCTCCGGTCCTGGACCTCGGCGACCCGGGTATGCCTG
GACGCCCAGGTCAGCCCGCAACAGCTCGCGGTGACCGAACAGGCGCTGACCGCCCTCGAC
GAGATCGACGCGGTCACCGGCGGTCGGGACGCCGCGGTGCTGGTGGGGGTGGTGGCGGAG
CTGGCGGCCAACACGGTGGGCAACGCCGTCCTGGCCGTCACCGAGCTTCCCGAACTGGCG
GCACGACTTGCCGACGACCCGGAGACCGCGACCCGTGTGGTGACGGAGGTGTCGCGGACG
AGTCCCGGCGTCCACCTGGAACGCCGCACCGCCGCGTCGGACCGCCGGGTGGGCGGGGTC
GACGTCCCGACCGGTGGCGAGGTGACAGTGGTCGTCGCCGCGGCGAACCGTGATCCCGAG
GTCTTCACCGATCCCGACCGGTTCGACGTGGACCGTGGCGGCGACGCCGAGATCCTGTCG
TCCCGGCCCGGCTCGCCCCGCACCGACCTCGACGCCCTGGTGGCCACCCTGGCCACGGCG
GCGCTGCGGGCCGCCGCGCCGGTGTTGCCCCGGCTGTCCCGTTCCGGGCCGGTGATCAGA
CGACGTCGGTCACCCGTCGCCCGTGGTCTCAGCCGTTGCCCGGTCGAGCTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [35-204]  5.30000000000001e-28 G3DSA:1.10.630.10 [222-313]  5.30000000000001e-28 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [251-312]  7.20000000000001e-09 PF00067
PF00067   p450
 [41-312]  2.30000440726534e-27 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [141-157]  1e-07 PR00359 [297-312]  1e-07 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit