close all open/close all

CDS information : Megalo_00030


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction2,072 / 3,382 / + [in whole cluster]
2,072 / 3,382 / + [in contig]
Location2072..3382 [in whole cluster]
2072..3382 [in contig]
TypeCDS
Length1,311 bp (436 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-L-megosamine glycosyltransferase
Product (GenBank)TDP-megosamine glycosyltransferase
Gene
Gene (GenBank)megDI
EC number
Keyword
  • megosamine
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>dTDP-L-megosamine glycosyltransferase [TDP-megosamine glycosyltransferase]
MRVVFSSMAVNSHLFGLVPLASAFQAAGHEVRVVASPALTDDVTGAGLTAVPVGDDVELV
EWHAHAGQDIVEYMRTLDWVDQSHTTMSWDDLLGMQTTFTPTFFALMSPDSLIDGMVEFC
RSWRPDWIVWEPLTFAAPIAARVTGTPHARMLWGPDVATRARQSFLRLLAHQEVEHREDP
LAEWFDWTLRRFGDDPHLSFDEELVLGQWTVDPIPEPLRIDTGVRTVGMRYVPYNGPSVV
PAWLLREPERRRVCLTLGGSSREHGIGQVSIGEMLDAIADIDAEFVATFDDQQLVGVGSV
PANVRTAGFVPMNVLLPTCAATVHHGGTGSWLTAAIHGVPQIILSDADTEVHAKQLQDLG
AGLSLPVAGMTAEHLRGAIERVLDEPAYRLGAERMRDGMRTDPSPAQVVGICQDLAADRA
ARGRQPRRTAEPHLPR
selected fasta
>dTDP-L-megosamine glycosyltransferase [TDP-megosamine glycosyltransferase]
ATGCGCGTCGTGTTTTCATCGATGGCTGTCAACAGCCATCTGTTCGGGCTGGTCCCGCTC
GCAAGCGCCTTCCAGGCGGCCGGACACGAGGTACGGGTCGTCGCCTCGCCGGCCCTGACC
GACGACGTCACCGGTGCCGGTCTGACCGCCGTGCCCGTCGGTGACGACGTGGAACTTGTG
GAGTGGCACGCCCACGCGGGCCAGGACATCGTCGAGTACATGCGGACCCTCGACTGGGTC
GACCAGAGCCACACCACCATGTCCTGGGACGACCTCCTGGGCATGCAGACCACCTTCACC
CCGACCTTCTTCGCCCTGATGAGCCCCGACTCGCTCATCGACGGGATGGTCGAGTTCTGC
CGCTCCTGGCGTCCCGACTGGATCGTCTGGGAGCCGCTGACCTTCGCCGCCCCGATCGCG
GCCCGGGTCACCGGAACCCCGCACGCCCGGATGCTGTGGGGTCCGGACGTCGCCACCCGG
GCCCGGCAGAGCTTCCTGCGACTGCTGGCCCACCAGGAGGTGGAGCACCGGGAGGATCCG
CTGGCCGAGTGGTTCGACTGGACGCTGCGGCGCTTCGGCGACGACCCGCACCTGAGCTTC
GACGAGGAACTGGTGCTGGGGCAGTGGACCGTGGACCCCATCCCCGAGCCGCTGCGGATC
GACACCGGCGTCCGGACGGTGGGCATGCGGTACGTCCCCTACAACGGCCCCTCGGTGGTG
CCCGCCTGGCTGTTGCGGGAACCCGAACGTCGGCGGGTCTGCCTGACCCTCGGCGGTTCC
AGCCGGGAACACGGCATCGGGCAGGTCTCCATCGGCGAGATGTTGGACGCCATCGCCGAC
ATCGACGCCGAGTTCGTGGCCACCTTCGACGACCAGCAGTTGGTCGGCGTGGGCAGCGTT
CCGGCAAACGTCCGTACCGCCGGGTTCGTGCCGATGAACGTCCTGCTGCCCACCTGCGCG
GCCACCGTGCACCACGGCGGCACCGGCAGTTGGCTGACCGCCGCCATCCACGGCGTACCG
CAGATCATCCTCTCGGACGCCGACACCGAGGTGCACGCCAAGCAGCTCCAGGACCTCGGC
GCGGGGCTGTCGCTCCCGGTCGCGGGGATGACCGCCGAGCACCTGCGTGGGGCGATCGAG
CGGGTTCTCGACGAGCCGGCGTACCGCCTCGGTGCGGAGCGGATGCGGGACGGGATGCGG
ACCGACCCGTCGCCGGCCCAGGTGGTCGGCATCTGTCAGGACCTGGCCGCCGACCGGGCG
GCACGCGGCAGGCAGCCGCGTCGAACCGCCGAGCCGCACCTGCCGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-84]  1.8e-11 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [211-305]  1.9e-33 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.575 Signal
Bacteria, Gram-positive   
 [1-28]  0.957 Signal
Eukaryota   
 [1-28]  0.789 Signal
Bacteria, Gram-negative   
TMHMM No significant hit