close all open/close all

CDS information : Megalo_00040


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction3,462 / 4,634 / + [in whole cluster]
3,462 / 4,634 / + [in contig]
Location3462..4634 [in whole cluster]
3462..4634 [in contig]
TypeCDS
Length1,173 bp (390 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productmycarose O-acyltransferase
Product (GenBank)mycarose O-acyltransferase
Gene
Gene (GenBank)megY
EC number2.3.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
Related Reference
ACC
Q56074
PmId
[8074537] Cloning of the macrolide antibiotic biosynthesis gene acyA, which encodes 3-O-acyltransferase, from Streptomyces thermotolerans and its use for direct fermentative production of a hybrid macrolide antibiotic. (Appl Environ Microbiol. , 1994)
ACC
Q00718
PmId
[1629172] A macrolide 3-O-acyltransferase gene from the midecamycin-producing species Streptomyces mycarofaciens. (J Bacteriol. , 1992)
ACC
P21542
PmId
[7764361] Cloning and nucleotide sequences of two genes involved in the 4''-O-acylation of macrolide antibiotics from Streptomyces thermotolerans. (Biosci Biotechnol Biochem. , 1993)

close this sectionSequence

selected fasta
>mycarose O-acyltransferase [mycarose O-acyltransferase]
MVTSTNLDTTARPALNSLTGMRFVAAFLVFFTHVLSRLIPNSYVYADGLDAFWQTTGRVG
VSFFFILSGFVLTWSARASDSVWSFWRRRVCKLFPNHLVTAFAAVVLFLVTGQAVSGEAL
IPNLLLIHAWFPALEISFGINPVSWSLACEAFFYLCFPLFLFWISGIRPERLWAWAAVVF
AAIWAVPVVADLLLPSSPPLIPGLEYSAIQDWFLYTFPATRSLEFILGIILARILITGRW
INVGLLPAVLLFPVFFVASLFLPGVYAISSSMMILPLVLIIASGATADLQQKRTFMRNRV
MVWLGDVSFALYMVHFLVIVYGADLLGFSQTEDAPLGLALFMIIPFLAVSLVLSWLLYRF
VELPVMRNWARPASARRKPATEPEQTPSRR
selected fasta
>mycarose O-acyltransferase [mycarose O-acyltransferase]
GTGGTTACCTCCACCAACTTGGACACGACAGCACGGCCGGCACTGAACTCGTTGACCGGG
ATGCGGTTCGTCGCCGCCTTCCTGGTCTTCTTCACGCACGTCCTGTCGAGGCTCATCCCG
AACAGCTACGTGTACGCCGACGGCCTGGACGCCTTCTGGCAGACCACCGGACGGGTGGGG
GTGTCGTTCTTCTTTATTCTCAGCGGTTTCGTGCTGACCTGGTCGGCGCGGGCCAGCGAC
TCGGTGTGGTCGTTCTGGCGCAGACGGGTCTGCAAGCTCTTCCCCAACCACCTGGTCACC
GCCTTCGCCGCCGTGGTGTTGTTCCTGGTCACCGGGCAGGCGGTGAGCGGTGAGGCGCTG
ATCCCGAACCTCCTGCTGATCCACGCCTGGTTCCCGGCCCTGGAGATCTCCTTCGGCATC
AACCCGGTGAGCTGGTCGTTGGCCTGCGAGGCGTTCTTCTACCTGTGCTTCCCGCTGTTC
CTGTTCTGGATCTCCGGTATCCGCCCGGAGCGGCTGTGGGCCTGGGCCGCCGTGGTGTTC
GCCGCGATCTGGGCGGTACCGGTGGTCGCCGACCTCCTGCTGCCGAGTTCCCCGCCGCTG
ATCCCGGGGCTTGAGTACTCCGCCATCCAGGACTGGTTCCTCTACACCTTCCCTGCGACG
CGGAGCCTGGAGTTCATCCTCGGGATCATCCTGGCCCGCATCCTGATCACCGGTCGGTGG
ATCAACGTCGGGCTGCTCCCCGCGGTGCTGTTGTTCCCGGTCTTCTTCGTCGCCTCGCTC
TTCCTGCCGGGTGTCTACGCCATCTCCTCGTCGATGATGATCCTTCCCCTGGTTCTGATC
ATCGCCAGCGGCGCGACGGCCGACCTCCAGCAGAAGCGCACCTTCATGCGTAACCGGGTG
ATGGTGTGGCTCGGCGACGTCTCCTTCGCGCTCTACATGGTCCACTTCCTGGTGATCGTC
TACGGGGCGGACCTGCTGGGGTTCAGCCAGACCGAGGACGCCCCGCTGGGTCTCGCACTC
TTCATGATCATTCCGTTCCTCGCGGTCTCCCTGGTGCTGTCGTGGCTGCTGTACAGGTTC
GTCGAGCTACCCGTCATGCGTAACTGGGCCCGCCCGGCCTCCGCCCGGCGCAAACCCGCC
ACGGAACCCGAACAGACCCCTTCCCGCCGGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002656 Acyltransferase 3 (Domain)
 [16-358]  2.4e-32 PF01757
PF01757   Acyl_transf_3
SignalP
 [1-46]  0.448 Signal
Bacteria, Gram-positive   
 [1-36]  0.835 Signal
Eukaryota   
TMHMM
 [13-35]  Transmembrane (i-o) [50-72]  Transmembrane (o-i) [93-115]  Transmembrane (i-o) [143-165]  Transmembrane (o-i) [172-194]  Transmembrane (i-o) [214-236]  Transmembrane (o-i) [243-261]  Transmembrane (i-o) [265-287]  Transmembrane (o-i) [299-321]  Transmembrane (i-o) [336-358]  Transmembrane (o-i)
Transmembrane 10