close all open/close all

CDS information : Megalo_00050


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction4,651 / 5,775 / + [in whole cluster]
4,651 / 5,775 / + [in contig]
Location4651..5775 [in whole cluster]
4651..5775 [in contig]
TypeCDS
Length1,125 bp (374 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose C-3 aminotransferase
Product (GenBank)TDP-3-keto-6-deoxyhexose 3-aminotransaminase
Gene
Gene (GenBank)megDII
EC number2.6.1.-
Keyword
  • megosamine
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)
Related Reference
ACC
Q2PC67
NITE
Rubra_00230
PmId
[16614891] Functional characterization of ketoreductase (rubN6) and aminotransferase (rubN4) genes in the gene cluster of Streptomyces achromogenes var. rubradiris. (Biotechnol Lett. , 2006)

close this sectionSequence

selected fasta
>NDP-hexose C-3 aminotransferase [TDP-3-keto-6-deoxyhexose 3-aminotransaminase]
MTTYVWSYLLEYERERADILDAVQKVFASGSLILGQSVENFETEYARYHGIAHCVGVDNG
TNAVKLALESVGVGRDDEVVTVSNTAAPTVLAIDEIGARPVFVDVRDEDYLMDTDLVEAA
VTPRTKAIVPVHLYGQCVDMTALRELADRRGLKLVEDCAQAHGARRDGRLAGTMSDAAAF
SFYPTKVLGAYGDGGAVVTNDDETARALRRLRYYGMEEVYYVTRTPGHNSRLDEVQAEIL
RRKLTRLDAYVAGRRAVAQRYVDGLADLQDSHGLELPVVTDGNEHVFYVYVVRHPRRDEI
IKRLRDGYDISLNISYPWPVHTMTGFAHLGVASGSLPVTERLAGEIFSLPMYPSLPHDLQ
DRVIEAVREVITGL
selected fasta
>NDP-hexose C-3 aminotransferase [TDP-3-keto-6-deoxyhexose 3-aminotransaminase]
GTGACCACCTACGTCTGGTCCTATCTGTTGGAGTACGAGAGGGAACGAGCCGACATCCTC
GATGCGGTGCAGAAGGTCTTCGCCAGTGGCAGCCTGATCCTCGGTCAGAGTGTGGAGAAC
TTCGAGACCGAGTACGCCCGCTACCACGGGATCGCGCACTGCGTGGGCGTCGACAACGGC
ACCAACGCTGTGAAACTCGCGCTGGAGTCGGTAGGTGTCGGACGCGACGACGAGGTCGTC
ACGGTCTCCAACACCGCCGCCCCCACAGTCCTGGCCATCGACGAGATCGGCGCCCGGCCG
GTCTTCGTGGACGTCCGCGACGAGGACTACCTCATGGACACCGACCTGGTGGAGGCGGCG
GTCACCCCGCGTACCAAGGCCATCGTCCCGGTGCACCTGTACGGGCAGTGCGTGGACATG
ACAGCCCTGCGGGAACTGGCCGACCGGCGGGGCCTCAAGCTCGTGGAGGACTGCGCCCAG
GCCCACGGTGCCCGGCGGGACGGTCGGCTGGCCGGGACGATGAGCGACGCGGCGGCCTTC
TCGTTCTACCCGACGAAGGTCCTCGGCGCCTACGGCGACGGCGGCGCGGTCGTCACCAAC
GACGACGAGACAGCCCGCGCCCTGCGACGGCTGCGGTACTACGGGATGGAGGAGGTCTAC
TACGTCACCCGGACCCCGGGTCACAACAGCCGCCTCGACGAGGTGCAGGCCGAGATCCTG
CGGCGCAAACTGACCCGGCTCGACGCGTACGTCGCGGGTCGGCGGGCGGTCGCCCAGCGG
TACGTCGACGGGCTCGCCGACCTCCAAGACTCGCACGGCCTCGAACTCCCAGTGGTCACC
GACGGCAACGAACACGTCTTCTACGTGTACGTCGTCCGCCACCCGCGCCGCGACGAGATC
ATCAAGCGTCTCCGGGACGGGTACGACATCTCCCTGAACATCAGCTACCCCTGGCCGGTG
CACACCATGACCGGCTTCGCCCACCTCGGTGTCGCGTCGGGGTCGCTGCCGGTCACCGAA
CGGCTGGCCGGCGAGATCTTCTCCCTTCCCATGTACCCCTCCCTCCCTCACGACCTGCAG
GACAGGGTGATCGAGGCGGTGCGGGAGGTCATCACCGGGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [14-368]  1.10000000000001e-117 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-374]  1e-94 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [16-245]  3.49999999999995e-77 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [247-371]  3.5e-34 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [16-374]  4.99996518094122e-101 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit