close all open/close all

CDS information : Megalo_00060


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction5,822 / 6,595 / + [in whole cluster]
5,822 / 6,595 / + [in contig]
Location5822..6595 [in whole cluster]
5822..6595 [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose N,N-dimethyltransferase
Product (GenBank)daunosaminyl-N,N-dimethyltransferase
Gene
Gene (GenBank)megDIII
EC number2.1.1.-
Keyword
  • megosamine
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>NDP-hexose N,N-dimethyltransferase [daunosaminyl-N,N-dimethyltransferase]
MPNSHSTTSSTDVAPYERADIYHDFYHGRGKGYRAEADALVEVARKHTPQAATLLDVACG
TGSHLVELADSFREVVGVDLSAAMLATAARNDPGRELHQGDMRDFSLDRRFDVVTCMFSS
TGYLVDEAELDRAVANLAGHLAPGGTLVVEPWWFPETFRPGWVGADLVTSGDRRISRMSH
TVPAGLPDRTASRMTIHYTVGSPEAGIEHFTEVHVMTLFARAAYEQAFQRAGLSCSYVGH
DLFSPGLFVGVAAEPGR
selected fasta
>NDP-hexose N,N-dimethyltransferase [daunosaminyl-N,N-dimethyltransferase]
ATGCCGAACAGCCACTCGACCACGTCGAGCACCGACGTCGCCCCGTACGAGCGGGCGGAC
ATCTACCACGACTTCTACCACGGCCGTGGCAAGGGATACCGTGCCGAAGCCGACGCGCTC
GTGGAGGTCGCCCGCAAGCACACCCCACAGGCGGCGACCCTGCTGGACGTGGCCTGCGGG
ACCGGATCCCACCTGGTCGAGCTGGCGGACAGCTTCCGGGAGGTGGTGGGGGTCGACCTG
TCGGCCGCCATGCTCGCCACCGCCGCCCGCAACGACCCCGGGCGGGAACTGCACCAGGGC
GACATGCGCGACTTCTCCCTCGACCGCAGGTTCGACGTCGTCACCTGCATGTTCAGCTCC
ACCGGTTACCTCGTCGACGAGGCCGAACTGGACCGTGCCGTGGCGAACCTGGCCGGTCAC
CTCGCGCCTGGCGGCACCCTCGTCGTGGAGCCCTGGTGGTTCCCGGAGACGTTCCGGCCC
GGCTGGGTCGGGGCCGACCTGGTCACCAGCGGTGACCGGAGGATCTCCCGGATGTCGCAC
ACCGTCCCGGCGGGTCTGCCCGACCGCACCGCCTCCCGGATGACCATCCACTACACGGTG
GGGTCACCGGAGGCCGGGATCGAGCACTTCACCGAGGTGCACGTGATGACCCTGTTCGCC
CGCGCCGCCTACGAGCAGGCCTTCCAGCGGGCGGGCCTGAGCTGCTCGTACGTCGGCCAC
GACCTGTTCTCGCCGGGCCTTTTCGTCGGGGTCGCCGCGGAGCCGGGGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit