close all open/close all

CDS information : Megalo_00070


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction6,592 / 7,197 / + [in whole cluster]
6,592 / 7,197 / + [in contig]
Location6592..7197 [in whole cluster]
6592..7197 [in contig]
TypeCDS
Length606 bp (201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)TDP-4-keto-6-deoxyhexose 3,5-epimerase
Gene
Gene (GenBank)megDIV
EC number5.1.3.-
Keyword
  • megosamine
  • mycarose
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)
Related Reference
ACC
Q9S0P2
NITE
Aver_00150
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [TDP-4-keto-6-deoxyhexose 3,5-epimerase]
MRVEELGIEGVFTFTPQTFADERGVFGTAYQEDVFVAALGRPLFPVAQVSTTRSRRGVVR
GVHFTTMPGSMAKYVYCARGRAMDFAVDIRPGSPTFGRAEPVELSAESMVGLYLPVGMGH
LFVSLEDDTTLVYLMSAGYVPDKERAVHPLDPELALPIPADLDLVMSERDRVAPTLREAR
DQGILPDYAACRAAAHRVVRT
selected fasta
>putative NDP-hexose epimerase [TDP-4-keto-6-deoxyhexose 3,5-epimerase]
GTGAGGGTCGAGGAGCTGGGCATCGAGGGGGTCTTCACCTTCACCCCGCAGACGTTCGCC
GACGAGCGGGGGGTGTTCGGCACGGCGTACCAGGAGGACGTGTTCGTGGCGGCGCTCGGC
CGCCCGCTGTTCCCGGTGGCCCAGGTCAGCACCACCCGGTCCCGGCGGGGTGTGGTCCGG
GGGGTGCACTTCACGACGATGCCCGGCTCCATGGCGAAGTACGTCTACTGCGCCAGGGGT
AGGGCGATGGACTTCGCCGTCGACATCCGGCCCGGTTCCCCGACCTTCGGCCGGGCCGAG
CCGGTCGAGCTCTCCGCCGAGTCGATGGTCGGGCTGTACCTTCCCGTGGGCATGGGCCAC
CTGTTCGTCTCCCTGGAGGACGACACCACCCTCGTCTACCTGATGTCCGCCGGTTACGTC
CCCGACAAGGAACGGGCGGTGCACCCCCTGGATCCGGAGCTGGCGTTGCCGATCCCGGCC
GACCTCGACCTCGTCATGTCCGAGCGGGACCGGGTCGCACCCACCCTCCGGGAGGCCCGG
GACCAGGGGATCCTGCCCGACTACGCCGCCTGCCGGGCCGCCGCGCACCGGGTGGTGCGG
ACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [1-183]  PD001462
PD001462   dTDP_sugar_isom
 [4-178]  9.29999999999998e-50 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-183]  4.39999001237725e-63 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-191]  4.9e-56 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP
 [1-20]  0.119 Signal
Bacteria, Gram-negative   
 [1-20]  0.075 Signal
Eukaryota   
TMHMM No significant hit