close all open/close all

CDS information : Megalo_00080


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction7,220 / 8,206 / + [in whole cluster]
7,220 / 8,206 / + [in contig]
Location7220..8206 [in whole cluster]
7220..8206 [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-hexose C-4 ketoreductase
Product (GenBank)TDP-4-keto-6-deoxyhexose 4-ketoreductase
Gene
Gene (GenBank)megDV
EC number
Keyword
  • L-megosamine
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>dTDP-hexose C-4 ketoreductase [TDP-4-keto-6-deoxyhexose 4-ketoreductase]
MVVLGASGFLGSAVTHALADLPVRVRLVARREVVVPSGAVADYETHRVDLTEPGALAEVV
ADARAVFPFAAQIRGTSGWRISEDDVVAERTNVGLVRDLIAVLSRSPHAPVVVFPGSNTQ
VGRVTAGRVIDGSEQDHPEGVYDRQKHTGEQLLKEATAAGAIRATSLRLPPVFGVPAAGT
ADDRGVVSTMIRRALTGQPLTMWHDGTVRRELLYVTDAARAFVTALDHADALAGRHFLLG
TGRSWPLGEVFQAVSRSVARHTGEDPVPVVSVPPPAHMDPSDLRSVEVDPARFTAVTGWR
ATVTMAEAVDRTVAALAPRRAAAPSEPS
selected fasta
>dTDP-hexose C-4 ketoreductase [TDP-4-keto-6-deoxyhexose 4-ketoreductase]
GTGGTGGTGCTCGGCGCGTCGGGTTTCCTGGGTTCGGCGGTCACCCACGCCCTGGCCGAC
CTCCCGGTGCGGGTGCGGCTCGTCGCCCGGCGGGAGGTCGTCGTGCCCTCCGGTGCCGTC
GCCGACTACGAGACGCACCGGGTGGACCTCACCGAACCCGGAGCGCTCGCGGAGGTGGTC
GCGGACGCCCGGGCGGTCTTCCCGTTCGCCGCCCAGATCAGGGGTACGTCAGGGTGGCGG
ATCAGCGAGGACGACGTGGTCGCCGAACGGACGAACGTCGGCCTGGTCCGGGACCTGATC
GCCGTCCTGTCCCGCTCGCCGCACGCCCCGGTGGTGGTCTTCCCGGGCAGCAACACGCAG
GTCGGCAGGGTCACCGCCGGCCGGGTCATCGACGGCAGCGAGCAGGACCACCCCGAGGGC
GTCTACGACAGGCAGAAACACACCGGGGAACAGCTGCTCAAGGAGGCCACTGCGGCCGGG
GCGATCCGGGCGACCAGTCTGCGGCTGCCCCCGGTGTTCGGGGTGCCCGCCGCCGGCACC
GCCGACGACCGGGGGGTGGTCTCCACCATGATCCGTCGGGCCCTGACCGGCCAACCGCTG
ACGATGTGGCACGACGGCACCGTCCGGCGTGAACTGCTGTACGTGACCGACGCCGCCCGG
GCCTTCGTCACCGCCCTGGACCACGCCGACGCGCTCGCCGGACGCCACTTCCTGTTGGGG
ACGGGGCGTTCCTGGCCGCTGGGCGAGGTCTTCCAGGCGGTCTCGCGCAGCGTCGCCCGG
CACACCGGCGAGGACCCGGTGCCGGTGGTCTCGGTGCCGCCTCCGGCGCACATGGACCCG
TCGGACCTGCGCAGCGTGGAGGTCGACCCCGCCCGGTTCACGGCTGTCACCGGGTGGCGG
GCCACGGTCACGATGGCGGAGGCGGTCGACCGGACGGTGGCGGCGTTGGCCCCCCGCCGG
GCCGCCGCCCCGTCCGAGCCCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [1-240]  5.10000000000004e-46 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [2-194]  1.99999999999999e-24 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-41]  0.297 Signal
Bacteria, Gram-positive   
 [1-19]  0.986 Signal
Eukaryota   
 [1-19]  0.9 Signal
Bacteria, Gram-negative   
TMHMM No significant hit