close all open/close all

CDS information : Megalo_00090


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction9,220 / 8,228 / - [in whole cluster]
9,220 / 8,228 / - [in contig]
Locationcomplement(8228..9220) [in whole cluster]
complement(8228..9220) [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-hexose C-3 ketoreductase component
Product (GenBank)TDP-4-keto-6-deoxyhexose 2,3-reductase
GenemegBIIb
Gene (GenBank)megDVII
EC number
Keyword
  • mycarose
  • axial-OH
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[17571859] Characterization of the heterodimeric MegBIIa:MegBIIb aldo-keto reductase involved in the biosynthesis of L-mycarose from Micromonospora megalomicea. (Biochemistry. , 2007)

close this sectionSequence

selected fasta
>dTDP-hexose C-3 ketoreductase component [TDP-4-keto-6-deoxyhexose 2,3-reductase]
MGTTGAGSARVRVGRSALHTSRLWLGTVNFSGRVTDDDALRLMDHALERGVNCIDTADIY
GWRLYKGHTEELVGRWFAQGGGRREETVLATKVGSEMSERVNDGGLSARHIVAACENSLR
RLGVDHIDIYQTHHIDRAAPWDEVWQAAEHLVGSGKVGYVGSSNLAGWHIAAAQESAARR
NLLGMISHQCLYNLAVRHPELDVLPAAQAYGVGVFAWSPLHGGLLSGVLEKLAAGTAVKS
AQGRAQVLLPAVRPLVEAYEDYCRRLGADPAEVGLAWVLSRPGILGAVIGPRTPEQLDSA
LRAAELTLGEEELRELEAIFPAPAVDGPVP
selected fasta
>dTDP-hexose C-3 ketoreductase component [TDP-4-keto-6-deoxyhexose 2,3-reductase]
GTGGGAACCACCGGGGCCGGGTCCGCCCGGGTACGCGTCGGACGATCGGCGTTGCACACC
AGCCGACTCTGGCTCGGCACCGTGAACTTCAGTGGACGGGTGACCGACGACGACGCGCTG
CGGCTGATGGACCACGCCCTCGAGCGGGGCGTCAACTGCATCGACACCGCCGACATCTAC
GGCTGGCGGCTCTACAAGGGCCACACCGAGGAACTCGTCGGACGGTGGTTCGCCCAGGGC
GGAGGTCGACGCGAGGAGACCGTCCTGGCGACCAAGGTGGGCAGCGAGATGAGCGAACGG
GTCAACGACGGCGGGCTCTCCGCCCGACACATCGTCGCCGCCTGCGAGAACTCCCTCCGC
CGCCTCGGGGTCGACCACATCGACATCTACCAGACGCACCACATCGACCGCGCCGCACCG
TGGGACGAGGTGTGGCAGGCCGCCGAACATCTGGTCGGCAGTGGGAAGGTCGGGTACGTC
GGCTCCTCCAACCTGGCGGGCTGGCACATCGCCGCCGCCCAGGAGAGCGCGGCACGCCGC
AACCTGCTCGGCATGATCTCCCACCAGTGCCTGTACAACCTGGCCGTCCGCCACCCCGAG
CTGGACGTCCTGCCCGCCGCCCAGGCGTACGGGGTGGGCGTGTTCGCCTGGTCCCCCCTG
CACGGCGGGCTGCTCAGCGGCGTACTGGAGAAGTTGGCAGCCGGAACCGCCGTCAAGTCG
GCGCAGGGACGCGCCCAGGTGCTCCTCCCCGCCGTACGCCCCCTCGTCGAGGCGTACGAG
GACTACTGCCGACGCCTCGGCGCGGACCCGGCCGAGGTCGGTCTGGCCTGGGTCCTGTCC
CGCCCCGGGATCCTGGGCGCTGTCATCGGCCCCCGCACACCCGAGCAGCTCGACTCGGCG
TTACGGGCCGCCGAGCTGACGCTGGGCGAGGAGGAACTCCGGGAACTCGAAGCGATCTTC
CCGGCACCGGCCGTCGACGGGCCGGTGCCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [18-322]  5.00000000000001e-84 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
 [8-328]  6.29998179434741e-84 SSF51430
SSF51430   Aldo/ket_red
 [23-320]  3.99999999999998e-64 PF00248
PF00248   Aldo_ket_red
SignalP No significant hit
TMHMM No significant hit