close all open/close all

CDS information : Megalo_00100


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction10,479 / 9,226 / - [in whole cluster]
10,479 / 9,226 / - [in contig]
Locationcomplement(9226..10479) [in whole cluster]
complement(9226..10479) [in contig]
TypeCDS
Length1,254 bp (417 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-L-mycarose glycosyltransferase
Product (GenBank)TDP-mycarose glycosyltransferase
Gene
Gene (GenBank)megBV
EC number
Keyword
  • mycarose
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[15870344] Production of the potent antibacterial polyketide erythromycin C in Escherichia coli. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>dTDP-L-mycarose glycosyltransferase [TDP-mycarose glycosyltransferase]
MRVLLTSFAHRTHFQGLVPLAWALHTAGHDVRVASQPELTDVVVGAGLTSVPLGSDHRLF
DISPEAAAQVHRYTTDLDFARRGPELRSWEFLHGIEEATSRFVFPVVNNDSFVDELVEFA
MDWRPDLVLWEPFTFAGAVAAKACGAAHARLLWGSDLTGYFRSRSQDLRGQRPADDRPDP
LGGWLTEVAGRFGLDYSEDLAVGQWSVDQLPESFRLETGLESVHTRTLPYNGSSVVPQWL
RTSDGVRRVCFTGGYSALGITSNPQEFLRTLATLARFDGEIVVTRSGLDPASVPDNVRLV
DFVPMNILLPGCAAVIHHGGAGSWATALHHGVPQISVAHEWDCVLRGQRTAELGAGVFLR
PDEVDADTLWQALATVVEDRSHAENAEKLRQEALAAPTPAEVVPVLEALAHQHRADR
selected fasta
>dTDP-L-mycarose glycosyltransferase [TDP-mycarose glycosyltransferase]
GTGCGGGTCCTGCTCACCTCGTTCGCGCACCGTACCCACTTCCAGGGCCTCGTCCCCCTG
GCCTGGGCGCTGCACACCGCCGGCCACGACGTCCGGGTGGCCAGTCAGCCCGAGCTCACC
GACGTCGTCGTCGGCGCGGGACTGACCTCGGTGCCACTCGGCTCGGACCACCGACTCTTC
GACATCTCCCCTGAGGCCGCCGCGCAGGTGCACCGCTACACCACCGACCTGGACTTCGCC
CGACGCGGACCGGAACTGCGCTCGTGGGAGTTCCTGCACGGCATCGAGGAGGCCACCTCC
CGGTTCGTCTTCCCGGTGGTCAACAACGACTCCTTCGTCGACGAACTCGTCGAGTTCGCC
ATGGACTGGCGTCCCGACCTGGTGCTCTGGGAGCCCTTCACCTTCGCCGGGGCGGTCGCG
GCCAAGGCCTGCGGGGCCGCCCACGCCCGGCTGCTGTGGGGCAGCGACCTCACCGGCTAC
TTCCGCAGCCGCTCCCAGGACCTGCGCGGGCAGCGTCCCGCCGACGACCGGCCGGACCCG
CTCGGCGGCTGGCTCACCGAGGTCGCCGGCCGGTTCGGCCTCGACTACAGCGAGGACCTC
GCTGTCGGACAGTGGAGCGTCGACCAGCTGCCCGAGAGCTTCCGCCTGGAGACCGGACTG
GAGTCGGTGCACACCCGGACTTTGCCCTACAACGGGTCCTCCGTCGTGCCGCAGTGGCTC
AGGACCTCGGACGGAGTCCGCCGGGTCTGCTTCACCGGGGGATACTCGGCGCTGGGCATC
ACCTCGAACCCGCAGGAGTTCCTCCGGACACTGGCCACCCTCGCGCGGTTCGACGGCGAG
ATCGTGGTGACCCGCTCCGGGCTCGATCCGGCGTCGGTGCCGGACAACGTCCGCCTGGTG
GACTTCGTTCCCATGAACATCCTGCTGCCGGGCTGTGCCGCCGTCATCCACCACGGCGGT
GCCGGAAGCTGGGCCACCGCGCTGCACCACGGCGTACCGCAGATCTCCGTCGCCCACGAG
TGGGACTGTGTCCTGCGTGGTCAGCGCACCGCCGAGCTGGGAGCGGGTGTCTTCCTCCGT
CCGGACGAGGTCGACGCCGACACCCTCTGGCAGGCTCTCGCCACAGTGGTCGAGGACCGT
TCCCACGCCGAGAACGCCGAGAAGCTGCGGCAGGAGGCGCTGGCCGCGCCGACCCCCGCC
GAGGTCGTACCCGTGCTGGAGGCGCTCGCCCACCAGCACCGCGCCGACAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-130]  1e-15 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [207-298]  2.80000000000001e-22 PF06722
PF06722   DUF1205
SignalP
 [1-28]  0.897 Signal
Eukaryota   
 [1-23]  0.391 Signal
Bacteria, Gram-negative   
 [1-23]  0.412 Signal
Bacteria, Gram-positive   
TMHMM No significant hit