close all open/close all

CDS information : Megalo_00110


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction11,424 / 10,483 / - [in whole cluster]
11,424 / 10,483 / - [in contig]
Locationcomplement(10483..11424) [in whole cluster]
complement(10483..11424) [in contig]
TypeCDS
Length942 bp (313 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-4-keto-6-deoxyhexose C-4 ketoreductase
Product (GenBank)TDP-4-keto-6-deoxyhexose 4-ketoreductase
Gene
Gene (GenBank)megBIV
EC number
Keyword
  • mycarose
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[15870344] Production of the potent antibacterial polyketide erythromycin C in Escherichia coli. (Appl Environ Microbiol. , 2005)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>dTDP-4-keto-6-deoxyhexose C-4 ketoreductase [TDP-4-keto-6-deoxyhexose 4-ketoreductase]
MTRHVTLLGVSGFVGSALLREFTTHPLRLRAVARTGSRDQPPGSAGIEHLRVDLLEPGRV
AQVVADTDVVVHLVAYAAGGSTWRSAATVPEAERVNAGIMRDLVAALRARPGPAPVLLFA
STTQAANPAAPSRYAQHKIEAERILRQATEDGVVDGVILRLPAIYGHSGPSGQTGRGVVT
AMIRRALAGEPITMWHEGSVRRNLLHVEDVATAFTAALHNHEALVGDVWTPSADEARPLG
EIFETVAASVARQTGNPAVPVVSVPPPENAEANDFRSDDFDSTEFRTLTGWHPRVPLAEG
IDRTVAALISTKE
selected fasta
>dTDP-4-keto-6-deoxyhexose C-4 ketoreductase [TDP-4-keto-6-deoxyhexose 4-ketoreductase]
ATGACAAGACATGTCACACTTCTCGGCGTTTCTGGATTCGTCGGAAGCGCCCTTCTTCGC
GAATTTACCACACACCCTCTCCGACTGCGGGCCGTCGCGCGCACCGGGTCTCGCGACCAG
CCACCAGGCAGCGCCGGGATCGAGCACCTTCGAGTCGACCTGCTCGAACCCGGCCGGGTC
GCGCAGGTCGTCGCCGACACCGACGTCGTCGTGCATCTGGTCGCCTACGCCGCCGGCGGG
TCGACCTGGCGCAGCGCCGCCACGGTGCCCGAGGCCGAACGCGTCAACGCGGGCATCATG
CGCGACCTCGTCGCCGCGCTGCGGGCAAGACCCGGACCCGCGCCGGTGCTCCTGTTCGCC
AGCACCACCCAGGCCGCGAACCCCGCCGCCCCCAGCCGGTACGCCCAGCACAAGATCGAG
GCCGAGCGGATCCTGCGTCAGGCCACCGAGGACGGGGTCGTCGACGGGGTGATCCTGCGC
CTGCCCGCGATCTACGGCCACAGCGGCCCGTCGGGGCAGACCGGCCGGGGTGTCGTCACC
GCCATGATCCGGCGAGCCCTCGCCGGTGAGCCGATCACGATGTGGCACGAGGGCAGCGTG
CGCCGCAACCTCCTGCACGTCGAGGACGTGGCCACCGCGTTCACCGCCGCACTGCACAAC
CACGAGGCGCTGGTCGGCGACGTCTGGACGCCGAGCGCGGACGAGGCCCGACCCCTCGGC
GAGATCTTCGAGACCGTCGCCGCCAGCGTGGCACGTCAGACCGGCAACCCTGCGGTGCCC
GTCGTCAGCGTCCCTCCACCGGAGAACGCCGAGGCCAACGACTTCCGCAGCGACGACTTC
GACTCCACCGAGTTCCGGACGCTGACCGGCTGGCACCCCCGGGTGCCGCTGGCCGAGGGC
ATCGACCGGACCGTTGCCGCCCTCATCTCGACCAAGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [6-222]  2.4e-35 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [5-188]  6.50000000000001e-22 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-19]  0.669 Signal
Bacteria, Gram-negative   
 [1-33]  0.328 Signal
Bacteria, Gram-positive   
 [1-19]  0.899 Signal
Eukaryota   
TMHMM No significant hit