close all open/close all

CDS information : Megalo_00120


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction12,181 / 22,821 / + [in whole cluster]
12,181 / 22,821 / + [in contig]
Location12181..22821 [in whole cluster]
12181..22821 [in contig]
TypeCDS
Length10,641 bp (3,546 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)megalomicin 6-deoxyerythronolide B synthase 1
Gene
Gene (GenBank)megAI
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[15595843] Identification of domains within megalomicin and erythromycin polyketide synthase modules responsible for differences in polyketide production levels in Escherichia coli. (Biochemistry. , 2004)

close this sectionPKS/NRPS Module

0
1 methylmalonyl-CoA
2 methylmalonyl-CoA
AT109..424
ACP464..534
KS557..930
AT1083..1405
KR1661..1840
ACP1936..2006
KS2030..2398
AT2566..2884
KR3115..3293
ACP3389..3462

close this sectionSequence

selected fasta
>polyketide synthase [megalomicin 6-deoxyerythronolide B synthase 1]
MVDVPDLLGTRTPHPGPLPFPWPLCGHNEPELRARARQLHAYLEGISEDDVVAVGAALAR
ETRAQDGPHRAVVVASSVTELTAALAALAQGRPHPSVVRGVARPTAPVVFVLPGQGAQWP
GMATRLLAESPVFAAAMRACERAFDEVTDWSLTEVLDSPEHLRRVEVVQPALFAVQTSLA
ALWRSFGVRPDAVLGHSIGELAAAEVCGAVDVEAAARAAALWSREMVPLVGRGDMAAVAL
SPAELAARVERWDDDVVPAGVNGPRSVLLTGAPEPIARRVAELAAQGVRAQVVNVSMAAH
SAQVDAVAEGMRSALTWFAPGDSDVPYYAGLTGGRLDTRELGADHWPRSFRLPVRFDEAT
RAVLELQPGTFIESSPHPVLAASLQQTLDEVGSPAAIVPTLQRDQGGLRRFLLAVAQAYT
GGVTVDWTAAYPGVTPGHLPSAVAVETDEGPSTEFDWAAPDHVLRARLLEIVGAETAALA
GREVDARATFRELGLDSVLAVQLRTRLATATGRDLHIAMLYDHPTPHALTEALLRGPQEE
PGRGEETAHPTEAEPDEPVAVVAMACRLPGGVTSPEEFWELLAEGRDAVGGLPTDRGWDL
DSLFHPDPTRSGTAHQRAGGFLTGATSFDAAFFGLSPREALAVEPQQRITLELSWEVLER
AGIPPTSLRTSRTGVFVGLIPQEYGPRLAEGGEGVEGYLMTGTTTSVASGRVAYTLGLEG
PAISVDTACSSSLVAVHLACQSLRRGESTMALAGGVTVMPTPGMLVDFSRMNSLAPDGRS
KAFSAAADGFGMAEGAGMLLLERLSDARRHGHPVLAVIRGTAVNSDGASNGLSAPNGRAQ
VRVIRQALAESGLTPHTVDVVETHGTGTRLGDPIEARALSDAYGGDREHPLRIGSVKSNI
GHTQAAAGVAGLIKLVLAMQAGVLPRTLHADEPSPEIDWSSGAISLLQEPAAWPAGERPR
RAGVSSFGISGTNAHAIIEEAPPTGDDTRPDRMGPVVPWVLSASTGEALRARAARLAGHL
REHPDQDLDDVAYSLATGRAALAYRSGFVPADASTALRILDELAAGGSGDAVTGTARAPQ
RVVFVFPGQGWQWAGMAVDLLDGDPVFASVLRECADALEPYLDFEIVPFLRAEAQRRTPD
HTLSTDRVDVVQPVLFAVMVSLAARWRAYGVEPAAVIGHSQGEIAAACVAGALSLDDAAR
AVALRSRVIATMPGNGAMASIAASVDEVAARIDGRVEIAAVNGPRAVVVSGDRDDLDRLV
ASCTVEGVRAKRLPVDYASHSSHVEAVRDALHAELGEFRPLPGFVPFYSTVTGRWVEPAE
LDAGYWFRNLRHRVRFADAVRSLADQGYTTFLEVSAHPVLTTAIEEIGEDRGGDLVAVHS
LRRGAGGPVDFGSALARAFVAGVAVDWESAYQGAGARRVPLPTYPFQRERFWLEPNPARR
VADSDDVSSLRYRIEWHPTDPGEPGRLDGTWLLATYPGRADDRVEAARQALESAGARVED
LVVEPRTGRVDLVRRLDAVGPVAGVLCLFAVAEPAAEHSPLAVTSLSDTLDLTQAVAGSG
RECPIWVVTENAVAVGPFERLRDPAHGALWALGRVVALENPAVWGGLVDVPSGSVAELSR
HLGTTLSGAGEDQVALRPDGTYARRWCRAGAGGTGRWQPRGTVLVTGGTGGVGRHVARWL
ARQGTPCLVLASRRGPDADGVEELLTELADLGTRATVTACDVTDREQLRALLATVDDEHP
LSAVFHVAATLDDGTVETLTGDRIERANRAKVLGARNLHELTRDADLDAFVLFSSSTAAF
GAPGLGGYVPGNAYLDGLAQQRRSEGLPATSVAWGTWAGSGMAEGPVADRFRRHGVMEMH
PDQAVEGLRVALVQGEVAPIVVDIRWDRFLLAYTAQRPTRLFDTLDEARRAAPGPDAGPG
VAALAGLPVGEREKAVLDLVRTHAAAVLGHASAEQVPVDRAFAELGVDSLSALELRNRLT
TATGVRLATTTVFDHPDVRTLAGHLAAELGGGSGRERPGGEAPTVAPTDEPIAIVGMACR
LPGGVDSPEQLWELIVSGRDTASAAPGDRSWDPAELMVSDTTGTRTAFGNFMPGAGEFDA
AFFGISPREALAMDPQQRHALETTWEALENAGIRPESLRGTDTGVFVGMSHQGYATGRPK
PEDEVDGYLLTGNTASVASGRIAYVLGLEGPAITVDTACSSSLVALHVAAGSLRSGDCGL
AVAGGVSVMAGPEVFREFSRQGALAPDGRCKPFSDEADGFGLGEGSAFVVLQRLSVAVRE
GRRVLGVVVGSAVNQDGASNGLAAPSGVAQQRVIRRAWGRAGVSGGDVGVVEAHGTGTRL
GDPVELGALLGTYGVGRGGVGPVVVGSVKANVGHVQAAAGVVGVIKVVLGLGRGLVGPMV
CRGGLSGLVDWSSGGLVVADGVRGWPVGVDGVRRGGVSAFGVSGTNAHVVVAEAPGSVVG
AERPVEGSSRGLVGVVGGVVPVVLSAKTETALHAQARRLADHLETHPDVPMTDVVWTLTQ
ARQRFDRRAVLLAADRTQAVERLRGLAGGEPGTGVVSGVASGGGVVFVFPGQGGQWVGMA
RGLLSVPVFVESVVECDAVVSSVVGFSVLGVLEGRSGAPSLDRVDVVQPVLFVVMVSLAR
LWRWCGVVPAAVVGHSQGEIAAAVVAGVLSVGDGARVVALRARALRALAGHGGMASVRRG
RDDVQKLLDSGPWTGKLEIAAVNGPDAVVVSGDPRAVTELVEHCDGIGVRARTIPVDYAS
HSAQVESLREELLSVLAGIEGRPATVPFYSTLTGGFVDGTELDADYWYRNLRHPVRFHAA
VEALAARDLTTFVEVSPHPVLSMAVGETLADVESAVTVGTLERDTDDVERFLTSLAEAHV
HGVPVDWAAVLGSGTLVDLPTYPFQGRRFWLHPDRGPRDDVADWFHRVDWTATATDGSAR
LDGRWLVVVPEGYTDDGWVVEVRAALAAGGAEPVVTTVEEVTDRVGDSDAVVSMLGLADD
GAAETLALLRRLDAQASTTPLWVVTVGAVAPAGPVQRPEQATVWGLALVASLERGHRWTG
LLDLPQTPDPQLRPRLVEALAGAEDQVAVRADAVHARRIVPTPVTGAGPYTAPGGTILVT
GGTAGLGAVTARWLAERGAEHLALVSRRGPGTAGVDEVVRDLTGLGVRVSVHSCDVGDRE
SVGALVQELTAAGDVVRGVVHAAGLPQQVPLTDMDPADLADVVAVKVDGAVHLADLCPEA
ELFLLFSSGAGVWGSARQGAYAAGNAFLDAFARHRRDRGLPATSVAWGLWAAGGMTGDQE
AVSFLRERGVRPMSVPRALEALERVLTAGETAVVVADVDWAAFAESYTSARPRPLLHRLV
TPAAAVGERDEPREQTLRDRLAALPRAERSAELVRLVRRDAAAVLGSDAKAVPATTPFKD
LGFDSLAAVRFRNRLAAHTGLRLPATLVFEHPNAAAVADLLHDRLGEAGEPTPVRSVGAG
LAALEQALPDASDTERVELVERLERMLAGLRPEAGAGADAPTAGDDLGEAGVDELLDALE
RELDAR
selected fasta
>polyketide synthase [megalomicin 6-deoxyerythronolide B synthase 1]
GTGGTTGACGTGCCCGATCTACTCGGCACCCGGACTCCGCACCCAGGGCCGCTCCCATTC
CCGTGGCCCCTGTGCGGTCACAACGAACCGGAGCTGCGGGCCCGCGCCCGTCAATTGCAC
GCATATCTCGAAGGCATTTCCGAGGATGACGTGGTGGCCGTCGGCGCCGCCCTCGCGCGC
GAGACACGCGCGCAGGACGGGCCGCACCGCGCCGTCGTCGTGGCCTCCTCGGTCACCGAG
CTGACCGCCGCGCTCGCCGCCCTCGCCCAGGGCCGCCCACACCCCTCGGTGGTACGCGGT
GTCGCCCGACCCACGGCACCGGTGGTGTTCGTCCTGCCCGGTCAGGGCGCCCAGTGGCCC
GGCATGGCGACCCGACTGCTCGCCGAGTCGCCCGTCTTCGCCGCGGCGATGCGGGCCTGC
GAGCGGGCCTTCGACGAGGTCACCGACTGGTCGTTGACCGAGGTCCTGGACTCACCCGAG
CACCTGCGCCGCGTCGAGGTGGTCCAGCCCGCGCTCTTCGCGGTGCAGACCTCACTGGCC
GCCCTGTGGCGGTCGTTCGGGGTGCGACCCGACGCCGTACTCGGACACAGCATCGGTGAG
CTGGCCGCCGCCGAGGTCTGCGGCGCCGTCGACGTCGAGGCCGCCGCGCGGGCCGCCGCC
CTGTGGAGCCGCGAGATGGTCCCACTGGTGGGCCGGGGTGACATGGCGGCGGTGGCGCTC
TCCCCGGCCGAGCTGGCAGCCCGGGTCGAGCGGTGGGACGACGACGTCGTGCCGGCCGGG
GTCAACGGTCCCCGGTCGGTGCTGCTCACCGGCGCTCCCGAGCCCATCGCACGGCGGGTC
GCCGAGCTGGCGGCACAGGGCGTACGCGCCCAGGTCGTCAACGTGTCGATGGCGGCGCAC
TCGGCGCAGGTCGACGCCGTCGCCGAGGGCATGCGCTCGGCGCTGACCTGGTTCGCCCCC
GGCGACTCCGACGTGCCCTACTACGCCGGCCTCACCGGCGGGCGGCTGGACACCCGGGAA
CTCGGCGCCGACCACTGGCCGCGCAGTTTCCGGCTCCCGGTGCGCTTCGACGAGGCGACC
CGTGCGGTCCTGGAACTGCAGCCCGGCACGTTCATCGAGTCGAGCCCGCACCCGGTGCTG
GCGGCCTCCCTGCAGCAGACCCTCGACGAGGTCGGGTCCCCGGCCGCGATCGTGCCGACC
CTGCAACGCGACCAGGGCGGTCTGCGGCGGTTCCTGCTCGCCGTGGCGCAGGCGTACACC
GGTGGCGTGACAGTCGACTGGACCGCCGCCTACCCCGGGGTGACCCCCGGCCACCTGCCG
TCGGCCGTCGCCGTCGAGACCGACGAGGGACCCTCGACGGAGTTCGACTGGGCCGCGCCC
GACCACGTACTGCGCGCGCGGCTGCTGGAGATCGTCGGCGCCGAGACGGCCGCGCTCGCC
GGGCGGGAGGTCGACGCCCGGGCCACCTTCCGGGAACTGGGCCTCGACTCGGTCCTCGCG
GTGCAGCTGCGGACCCGCCTCGCCACGGCGACCGGGCGGGATCTGCACATCGCCATGCTC
TACGACCACCCGACCCCGCACGCCCTCACCGAGGCGCTGCTGCGCGGCCCGCAGGAGGAG
CCGGGGCGGGGTGAGGAGACGGCACACCCGACGGAGGCCGAACCCGACGAACCCGTCGCC
GTGGTCGCCATGGCGTGCCGGCTGCCCGGCGGCGTCACCTCACCGGAGGAGTTCTGGGAG
CTGCTGGCCGAGGGGCGGGACGCCGTCGGCGGGCTGCCCACCGACCGGGGATGGGACCTG
GACTCGCTGTTCCACCCGGACCCGACCCGGTCGGGCACGGCGCACCAGCGCGCTGGTGGC
TTCCTCACCGGCGCCACCTCCTTCGACGCTGCCTTCTTCGGGCTGTCGCCACGGGAGGCA
CTGGCCGTCGAGCCGCAGCAGCGGATCACGTTGGAGCTGTCGTGGGAGGTGCTGGAACGC
GCCGGGATCCCCCCGACGTCGTTGCGGACCTCCCGGACCGGGGTGTTCGTCGGTCTGATC
CCCCAGGAGTACGGCCCCCGGCTGGCCGAGGGGGGTGAGGGCGTCGAGGGCTACCTGATG
ACCGGGACCACCACCAGCGTCGCCTCCGGTCGGGTCGCCTACACCCTCGGCCTGGAGGGG
CCGGCGATCAGCGTCGACACCGCCTGCTCGTCGTCGCTCGTCGCCGTGCACCTGGCGTGC
CAGTCGCTGCGGCGCGGCGAGTCGACGATGGCGCTCGCCGGTGGCGTGACGGTGATGCCG
ACACCGGGCATGCTCGTGGACTTCAGTCGGATGAACTCCCTCGCCCCCGACGGACGGTCC
AAGGCGTTCTCGGCCGCCGCCGACGGGTTCGGCATGGCCGAAGGCGCAGGGATGCTCCTG
CTGGAACGGCTCTCGGACGCCCGCCGCCACGGCCACCCGGTGCTCGCCGTGATCAGGGGC
ACCGCTGTCAACTCCGACGGCGCGAGCAACGGACTCTCCGCCCCGAACGGCCGGGCCCAG
GTCCGGGTGATCCGACAGGCCCTCGCCGAGTCCGGGCTGACGCCCCACACCGTCGACGTC
GTGGAGACCCACGGCACCGGCACCCGCCTCGGTGATCCGATCGAGGCACGGGCGCTCTCC
GACGCGTACGGCGGTGACCGTGAGCACCCGCTGCGGATCGGCTCGGTCAAGTCCAACATC
GGGCACACCCAGGCCGCCGCCGGTGTCGCCGGTCTGATCAAACTGGTGTTGGCGATGCAG
GCCGGTGTCCTGCCCCGCACCCTGCACGCCGACGAGCCGTCACCGGAGATCGACTGGTCC
TCGGGCGCGATCAGCCTGCTCCAGGAGCCCGCTGCCTGGCCCGCCGGCGAGCGGCCCCGC
CGGGCCGGGGTGTCCTCGTTCGGCATCAGCGGCACCAACGCACACGCGATCATCGAGGAG
GCGCCGCCGACCGGTGACGACACCCGACCCGACCGGATGGGCCCGGTGGTGCCCTGGGTG
CTCTCGGCGAGCACCGGCGAGGCGTTGCGCGCCCGGGCGGCGCGGCTGGCCGGGCACCTA
CGCGAGCACCCCGACCAGGACCTGGACGACGTCGCCTACTCGCTGGCCACCGGTCGGGCC
GCGCTGGCGTACCGTAGTGGGTTCGTGCCCGCCGACGCGTCCACGGCGCTGCGGATCCTC
GACGAACTCGCCGCCGGTGGATCCGGGGACGCGGTGACCGGCACCGCCCGCGCCCCGCAG
CGCGTCGTCTTCGTCTTCCCCGGCCAGGGATGGCAGTGGGCGGGGATGGCAGTCGACCTG
CTCGACGGCGACCCGGTCTTCGCCTCGGTGCTGCGGGAGTGCGCCGACGCGTTGGAACCG
TACCTGGACTTCGAGATCGTCCCGTTCCTGCGGGCCGAGGCGCAGCGCCGGACCCCCGAC
CACACGCTCTCCACCGACCGCGTCGACGTGGTCCAGCCGGTGCTGTTCGCGGTGATGGTG
TCCCTGGCGGCCCGGTGGCGGGCGTACGGGGTGGAACCGGCGGCCGTCATCGGACACTCC
CAGGGGGAGATTGCCGCGGCGTGTGTGGCCGGGGCGCTCTCGCTGGACGACGCGGCCCGG
GCGGTGGCCCTGCGCAGCCGGGTCATCGCCACCATGCCCGGCAACGGCGCGATGGCCTCG
ATCGCCGCCTCCGTCGACGAGGTGGCGGCCCGGATCGACGGGCGGGTCGAGATCGCCGCC
GTCAACGGTCCGCGCGCGGTGGTGGTCTCCGGCGACCGTGACGACCTGGACCGCCTGGTC
GCCTCCTGCACCGTCGAGGGGGTGCGGGCCAAGCGGCTGCCGGTGGACTACGCGTCGCAC
TCCTCGCACGTCGAGGCCGTCCGTGACGCGCTCCACGCCGAACTCGGCGAGTTCCGGCCG
CTGCCGGGCTTCGTGCCGTTCTACTCGACAGTCACCGGCCGCTGGGTCGAGCCCGCCGAA
CTCGACGCCGGGTACTGGTTTCGCAACCTGCGCCACAGGGTCCGGTTCGCCGACGCGGTC
CGCTCCCTCGCCGACCAGGGGTACACGACGTTCCTGGAGGTCAGCGCCCACCCGGTGCTC
ACCACGGCGATCGAGGAGATCGGTGAGGACCGTGGCGGTGACCTCGTCGCTGTCCACTCG
CTGCGACGTGGGGCCGGCGGTCCCGTCGACTTCGGCTCCGCGCTGGCCCGCGCCTTCGTG
GCCGGCGTCGCAGTGGACTGGGAGTCGGCGTACCAGGGTGCCGGGGCGCGTCGGGTGCCG
CTGCCCACGTACCCGTTCCAGCGTGAGCGCTTCTGGTTGGAACCGAATCCGGCCCGCAGG
GTCGCCGACTCCGACGACGTCTCGTCCCTGCGGTACCGCATCGAATGGCACCCGACCGAT
CCGGGTGAGCCGGGACGGCTCGACGGCACCTGGCTGCTGGCGACGTACCCCGGTCGGGCC
GACGACCGGGTCGAGGCGGCGCGGCAGGCGCTGGAGTCCGCCGGGGCGCGGGTCGAGGAC
CTGGTGGTGGAGCCCCGGACGGGCCGGGTCGACCTGGTGCGGCGGCTCGACGCCGTGGGT
CCGGTGGCGGGCGTGCTCTGCCTGTTCGCTGTCGCGGAGCCGGCGGCCGAACACTCCCCG
CTGGCGGTGACGTCGTTGTCGGACACGCTCGACCTGACCCAGGCGGTGGCCGGGTCGGGC
CGGGAGTGTCCGATCTGGGTGGTCACCGAGAACGCCGTCGCCGTCGGGCCCTTCGAACGG
CTCCGCGACCCGGCCCACGGCGCGCTCTGGGCCCTCGGTCGGGTCGTCGCCCTGGAGAAC
CCCGCCGTCTGGGGCGGCCTGGTCGACGTGCCGTCGGGTTCGGTCGCCGAGCTGTCGCGT
CACCTCGGGACGACCCTGTCCGGCGCCGGCGAGGACCAGGTCGCCCTCCGACCCGACGGG
ACGTACGCCCGCCGGTGGTGCAGGGCGGGCGCGGGCGGCACGGGCCGGTGGCAGCCCCGG
GGCACGGTGCTCGTCACCGGCGGCACCGGCGGGGTCGGTCGGCACGTCGCCCGGTGGCTG
GCCCGCCAGGGCACCCCGTGCCTGGTGCTGGCCAGCCGCCGGGGACCGGACGCCGACGGG
GTCGAGGAGCTACTCACCGAACTCGCCGACCTGGGCACCCGGGCCACCGTCACCGCCTGC
GACGTCACCGACCGGGAGCAGCTCCGTGCCCTCCTCGCGACCGTCGACGACGAGCACCCG
CTGTCGGCGGTGTTCCACGTCGCCGCGACGCTCGACGACGGCACCGTCGAGACCCTCACC
GGTGACCGCATCGAACGGGCCAACCGGGCGAAGGTGCTCGGTGCCCGCAACCTGCACGAG
CTGACCCGGGACGCCGACCTCGACGCGTTCGTGCTCTTCTCCTCCTCCACCGCCGCGTTC
GGCGCGCCGGGGCTCGGCGGCTACGTCCCGGGCAACGCCTACCTCGACGGTCTCGCCCAG
CAGCGACGCAGCGAGGGACTCCCGGCCACCTCGGTGGCGTGGGGTACCTGGGCGGGCAGC
GGGATGGCCGAGGGTCCGGTCGCCGACCGGTTCCGCCGGCACGGGGTCATGGAGATGCAC
CCCGACCAGGCCGTCGAGGGTCTCCGGGTGGCACTGGTGCAGGGTGAGGTAGCCCCGATC
GTCGTCGACATCAGGTGGGACCGGTTCCTCCTCGCGTACACCGCGCAGCGCCCCACCCGG
CTCTTCGACACCCTCGACGAGGCCCGTCGGGCCGCGCCCGGTCCCGACGCCGGGCCGGGG
GTGGCGGCGCTGGCCGGGCTGCCCGTCGGGGAACGCGAGAAGGCGGTCCTCGACCTGGTA
CGGACGCACGCGGCTGCCGTCCTCGGCCACGCCTCGGCCGAGCAGGTGCCCGTCGACAGG
GCCTTCGCCGAACTCGGCGTCGACTCGCTGTCGGCCCTGGAACTGCGCAACCGGCTGACC
ACTGCGACCGGGGTCCGGCTGGCCACGACGACGGTCTTCGACCACCCGGACGTACGGACC
CTGGCCGGACACCTGGCCGCCGAACTGGGCGGCGGATCGGGGCGGGAGCGGCCCGGGGGC
GAGGCCCCGACGGTGGCCCCGACCGACGAGCCGATCGCCATCGTCGGGATGGCCTGCCGG
CTGCCGGGGGGAGTGGACTCACCGGAGCAGCTGTGGGAGTTGATCGTCTCCGGGCGGGAC
ACCGCCTCGGCGGCACCCGGGGACCGGAGCTGGGATCCGGCGGAGTTGATGGTCTCCGAC
ACGACGGGCACCCGTACCGCCTTCGGCAACTTCATGCCCGGGGCGGGCGAGTTCGACGCG
GCGTTCTTCGGGATCTCGCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGCACGCC
CTGGAGACCACCTGGGAGGCGCTGGAGAACGCCGGTATCCGGCCCGAGTCGTTGCGCGGT
ACGGACACCGGTGTCTTCGTGGGCATGTCCCATCAGGGGTACGCCACCGGCCGCCCGAAG
CCCGAGGACGAGGTCGACGGCTACCTGTTGACAGGCAACACCGCGAGCGTCGCCTCCGGT
CGGATCGCGTACGTGTTGGGGTTGGAGGGGCCGGCGATCACTGTGGACACGGCGTGTTCG
TCGTCGCTTGTGGCGTTGCACGTGGCGGCGGGTTCGTTGCGTTCTGGGGACTGTGGTCTG
GCGGTGGCGGGTGGGGTGTCGGTGATGGCCGGTCCGGAGGTGTTCAGGGAGTTCTCCCGG
CAGGGCGCGTTGGCTCCGGACGGCAGGTGCAAGCCCTTCTCGGACGAGGCCGACGGCTTC
GGTCTGGGGGAGGGGTCGGCCTTCGTCGTGTTGCAGCGGTTGTCGGTGGCGGTGCGGGAG
GGGCGTCGGGTGTTGGGTGTGGTGGTGGGTTCGGCGGTGAATCAGGATGGGGCGAGTAAT
GGGTTGGCGGCGCCGTCGGGGGTGGCGCAGCAGCGGGTGATTCGGCGGGCGTGGGGTCGT
GCGGGTGTGTCGGGTGGGGATGTGGGTGTGGTGGAGGCGCATGGGACGGGGACGCGGTTG
GGGGATCCGGTGGAGTTGGGGGCGTTGTTGGGGACGTATGGGGTGGGTCGGGGTGGGGTG
GGTCCGGTGGTGGTGGGTTCGGTGAAGGCGAATGTGGGTCATGTGCAGGCGGCGGCGGGT
GTGGTGGGTGTGATCAAGGTGGTGTTGGGGTTGGGTCGGGGGTTGGTGGGTCCGATGGTG
TGTCGGGGTGGGTTGTCGGGGTTGGTGGATTGGTCGTCGGGTGGGTTGGTGGTGGCGGAT
GGGGTGCGGGGGTGGCCGGTGGGTGTGGATGGGGTGCGTCGGGGTGGGGTGTCGGCGTTT
GGGGTGTCGGGGACGAATGCTCATGTGGTGGTGGCGGAGGCGCCGGGGTCGGTGGTGGGG
GCGGAACGGCCGGTGGAGGGGTCGTCGCGGGGGTTGGTGGGGGTGGTTGGTGGTGTGGTG
CCGGTGGTGCTGTCGGCAAAGACCGAAACCGCCCTGCACGCCCAGGCACGTCGACTCGCC
GACCACCTGGAGACGCACCCCGACGTCCCGATGACCGACGTGGTGTGGACGCTGACGCAG
GCCCGCCAACGCTTCGACAGGCGCGCGGTCCTCCTCGCCGCCGACCGGACCCAGGCCGTG
GAACGGCTGCGCGGCCTCGCCGGGGGCGAACCGGGGACCGGTGTGGTGTCGGGGGTGGCG
TCGGGTGGTGGTGTGGTGTTTGTTTTTCCTGGTCAGGGTGGTCAGTGGGTGGGGATGGCG
CGGGGGTTGTTGTCGGTTCCGGTGTTTGTGGAGTCGGTGGTGGAGTGTGATGCGGTGGTG
TCGTCGGTGGTGGGGTTTTCGGTGTTGGGGGTGTTGGAGGGTCGGTCGGGTGCGCCGTCG
TTGGATCGGGTGGATGTGGTGCAGCCGGTGTTGTTCGTGGTGATGGTGTCGTTGGCGCGG
TTGTGGCGGTGGTGTGGGGTTGTGCCTGCGGCGGTGGTGGGTCATTCGCAGGGGGAGATC
GCGGCGGCGGTGGTGGCGGGGGTGTTGTCGGTGGGTGATGGTGCGCGGGTGGTGGCGTTG
CGGGCGCGGGCGTTGCGGGCGTTGGCCGGCCACGGCGGCATGGCCTCGGTACGCCGAGGC
CGCGACGACGTACAGAAGCTCCTCGACAGCGGCCCCTGGACGGGGAAGCTGGAGATCGCC
GCGGTCAACGGCCCCGACGCGGTGGTGGTCTCCGGCGACCCCCGAGCCGTGACCGAGCTG
GTCGAGCACTGTGACGGGATCGGGGTCCGGGCCCGGACGATCCCCGTCGACTACGCCTCC
CACTCCGCACAGGTCGAGTCGCTCCGGGAGGAGCTGCTCTCCGTCCTGGCCGGGATCGAG
GGCCGCCCGGCGACGGTGCCGTTCTACTCCACCCTCACCGGTGGGTTCGTCGACGGCACC
GAACTGGACGCCGACTACTGGTACCGCAACCTGCGCCACCCGGTGCGGTTCCACGCCGCC
GTCGAGGCGCTGGCAGCGCGTGACCTCACCACGTTCGTCGAGGTCAGCCCGCACCCCGTG
CTGTCGATGGCGGTCGGGGAGACGCTTGCCGACGTGGAGTCCGCCGTCACTGTGGGCACC
CTGGAACGCGACACCGACGACGTCGAGCGCTTCCTCACCTCCCTCGCCGAGGCGCACGTC
CACGGCGTACCCGTGGACTGGGCGGCGGTCCTCGGCTCCGGAACCCTGGTCGACCTGCCC
ACCTATCCCTTCCAGGGACGGCGGTTCTGGCTGCACCCCGACCGTGGTCCGCGTGACGAT
GTCGCCGACTGGTTCCACCGGGTCGACTGGACGGCGACGGCCACCGACGGGTCGGCCCGA
CTCGACGGTCGCTGGCTGGTGGTCGTACCCGAGGGGTACACGGACGACGGCTGGGTCGTG
GAGGTGCGGGCCGCCCTCGCCGCCGGTGGTGCCGAGCCGGTGGTGACGACGGTCGAGGAG
GTCACCGACCGGGTCGGTGACAGCGACGCGGTGGTGTCGATGCTCGGGCTGGCCGACGAC
GGTGCGGCCGAGACCCTGGCGCTGCTGCGACGACTCGACGCACAGGCGTCCACCACCCCA
CTGTGGGTGGTCACCGTGGGGGCCGTCGCCCCCGCCGGTCCGGTGCAGCGCCCCGAACAG
GCGACGGTGTGGGGGTTGGCCCTTGTCGCCTCCCTGGAACGCGGACACCGGTGGACCGGC
CTGCTGGATCTGCCGCAGACACCGGACCCGCAGCTACGACCCCGGCTGGTCGAGGCGCTC
GCCGGTGCCGAGGACCAGGTAGCGGTCCGCGCCGACGCCGTACACGCCCGTCGGATCGTC
CCCACCCCGGTCACCGGAGCCGGGCCGTACACCGCCCCGGGCGGGACGATCCTCGTCACC
GGGGGCACCGCCGGTCTGGGTGCCGTCACCGCCCGATGGCTCGCCGAGCGCGGTGCCGAA
CACCTCGCCCTGGTCAGCCGGCGCGGGCCGGGCACCGCCGGCGTCGACGAGGTGGTCCGG
GACCTGACCGGGCTCGGCGTACGGGTGTCGGTGCACTCCTGCGACGTCGGCGACCGCGAG
TCGGTCGGCGCCCTGGTGCAGGAGTTGACAGCAGCCGGTGACGTGGTCCGGGGGGTGGTC
CACGCTGCCGGTCTGCCCCAGCAGGTGCCACTGACCGACATGGACCCGGCCGACCTCGCC
GACGTGGTGGCCGTGAAGGTCGACGGCGCGGTGCACCTGGCCGACCTGTGCCCGGAGGCC
GAACTGTTCCTGCTGTTCTCCTCCGGGGCCGGGGTGTGGGGCAGTGCCCGTCAGGGTGCG
TACGCCGCCGGAAACGCCTTCCTGGACGCCTTCGCCCGACACCGGCGGGACCGGGGTCTG
CCCGCCACCTCGGTGGCGTGGGGGCTCTGGGCGGCCGGGGGGATGACAGGGGACCAGGAG
GCGGTGTCGTTCCTGCGTGAGCGGGGCGTACGGCCGATGTCGGTGCCGAGGGCACTGGAA
GCGCTGGAACGGGTCCTCACCGCCGGGGAGACCGCGGTGGTCGTCGCCGACGTCGACTGG
GCGGCCTTCGCCGAGTCGTACACCTCCGCCCGGCCCCGGCCGCTGCTCCACCGGCTCGTC
ACACCTGCGGCGGCGGTCGGCGAGCGCGACGAGCCGCGTGAGCAGACCCTCCGGGACCGG
CTGGCGGCCCTGCCCCGGGCCGAGCGGTCGGCGGAGCTGGTACGCCTGGTCCGGCGGGAC
GCCGCAGCCGTGCTCGGCAGCGACGCGAAGGCCGTACCCGCCACCACGCCGTTCAAGGAC
CTCGGGTTCGACTCGCTGGCCGCGGTCCGGTTCCGTAACCGGCTGGCCGCCCACACCGGT
CTGCGTCTGCCGGCCACCCTGGTCTTCGAGCACCCGAACGCCGCAGCCGTCGCCGACCTC
CTCCACGACCGACTCGGCGAGGCCGGCGAGCCGACCCCCGTCCGGTCGGTGGGCGCCGGA
CTGGCCGCGCTGGAGCAGGCCCTGCCCGACGCCTCCGACACGGAGCGGGTCGAGCTGGTC
GAGCGCCTGGAACGGATGCTCGCCGGGCTCCGCCCCGAGGCCGGAGCCGGGGCCGACGCC
CCGACCGCCGGTGACGACCTGGGGGAGGCCGGCGTCGACGAACTCCTCGACGCGCTCGAA
CGGGAACTCGACGCCAGGTGA
[0] AT109..424
[0] ACP464..534
[1] KS557..930
[1] AT1083..1405
[1] methylmalonyl-CoA1277..1281
[1] KR1661..1840
[1] ACP1936..2006
[2] KS2030..2398
[2] AT2566..2884
[2] methylmalonyl-CoA2758..2762
[2] KR3115..3293
[2] ACP3389..3462
[0] AT325..1272
[0] ACP1390..1602
[1] KS1669..2790
[1] AT3247..4215
[1] methylmalonyl-CoA3829..3843
[1] KR4981..5520
[1] ACP5806..6018
[2] KS6088..7194
[2] AT7696..8652
[2] methylmalonyl-CoA8272..8286
[2] KR9343..9879
[2] ACP10165..10386

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [99-229]  G3DSA:3.40.366.10 [297-412]  G3DSA:3.40.366.10 [1075-1212]  G3DSA:3.40.366.10 [1277-1388]  G3DSA:3.40.366.10 [2561-2688]  G3DSA:3.40.366.10 [2758-2874]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1661-1827]  3.2e-55 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [492-507]  PS00012 [1964-1979]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [464-534]  PS50075 [1936-2006]  PS50075 [3389-3462]  PS50075
PS50075   ACP_DOMAIN
 [467-532]  1.7e-10 PF00550 [1939-2005]  5e-12 PF00550 [3397-3461]  2.6e-11 PF00550
PF00550   PP-binding
 [457-573]  4.60000044330862e-19 SSF47336 [1929-2046]  6.39998633403535e-28 SSF47336 [3385-3479]  9.30000048475975e-22 SSF47336
SSF47336   ACP_like
 [460-536]  2.59999999999998e-47 G3DSA:1.10.1200.10 [1934-2010]  3.60000000000002e-55 G3DSA:1.10.1200.10 [3392-3467]  3.60000000000002e-55 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [3115-3292]  2.89999999999999e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [556-807]  1.99999999999999e-91 PF00109 [2029-2276]  1.10000000000001e-89 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [815-930]  1.99999999999999e-46 PF02801 [2285-2398]  1.2e-34 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [109-424]  2.59999999999995e-102 PF00698 [1083-1405]  7.40000000000007e-113 PF00698 [2566-2884]  5.40000000000002e-105 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [107-395]  2.19999900980707e-55 SSF52151 [1081-1386]  5.20000089003336e-65 SSF52151 [2564-2868]  5.60004908290974e-65 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [231-296]  6.80000200614766e-15 SSF55048 [1214-1276]  4.49999046578037e-18 SSF55048 [2690-2757]  8.80000265836278e-19 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [556-818]  G3DSA:3.40.47.10 [819-983]  1.39999999999997e-108 G3DSA:3.40.47.10 [2029-2288]  G3DSA:3.40.47.10 [2290-2455]  1.39999999999997e-108 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [549-929]  5.79999653854781e-102 SSF53901 [2022-2404]  1.59998835313644e-92 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1662-1846]  1.39999999999997e-77 G3DSA:3.40.50.720 [3114-3333]  3.10000000000005e-72 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [720-736]  PS00606 [2190-2206]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [111-405]  1.09999184471405e-81 SM00827 [1085-1385]  6.90004508941104e-117 SM00827 [2568-2865]  4.40002866058555e-112 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [469-537]  1.29999924468179e-18 SM00823 [1937-2009]  7.69998480533694e-31 SM00823 [3394-3465]  1.10000150671642e-28 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [559-983]  SM00825 [2032-2456]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1661-1840]  2.50000909916183e-55 SM00822 [3115-3293]  3.80000697093588e-45 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit