close all open/close all

CDS information : Megalo_00130


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction22,867 / 33,555 / + [in whole cluster]
22,867 / 33,555 / + [in contig]
Location22867..33555 [in whole cluster]
22867..33555 [in contig]
TypeCDS
Length10,689 bp (3,562 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)megalomicin 6-deoxyerythronolide B synthase 2
Gene
Gene (GenBank)megAII
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)

close this sectionPKS/NRPS Module

3 methylmalonyl-CoA
4 methylmalonyl-CoA
KS31..406
AT560..880
kr1124..1291
ACP1391..1461
KS1483..1856
AT2011..2330
DH2374..2537
ER2823..3123
KR3133..3313
ACP3409..3479

close this sectionSequence

selected fasta
>polyketide synthase [megalomicin 6-deoxyerythronolide B synthase 2]
MTDNDKVAEYLRRATLDLRAARKRLRELQSDPIAVVGMACRLPGGVHLPQHLWDLLRQGH
ETVSTFPTGRGWDLAGLFHPDPDHPGTSYVDRGGFLDDVAGFDAEFFGISPREATAMDPQ
QRLLLETSWELVESAGIDPHSLRGTPTGVFLGVARLGYGENGTEAGDAEGYSVTGVAPAV
ASGRISYALGLEGPSISVDTACSSSLVALHLAVESLRLGESSLAVVGGAAVMATPGVFVD
FSRQRALAADGRSKAFGAAADGFGFSEGVSLVLLERLSEAESNGHEVLAVIRGSALNQDG
ASNGLAAPNGTAQRKVIRQALRNCGLTPADVDAVEAHGTGTTLGDPIEANALLDTYGRDR
DPDHPLWLGSVKSNIGHTQAAAGVTGLLKMVLALRHEELPATLHVDEPTPHVDWSSGAVR
LATRGRPWRRGDRPRRAGVSAFGISGTNAHVIVEEAPERTTERTVGGDVGPVPLVVSARS
AAALRAQAAQVAELVEGSDVGLAEVGRSLAVTRARHEHRAAVVASTRAEAVRGLREVAAV
EPRGEDTVTGVAETSGRTVVFLFPGQGSQWVGMGAELLDSAPAFADTIRACDEAMAPLQD
WSVSDVLRQEPGAPGLDRVDVVQPVLFAVMVSLARLWQSYGVTPAAVVGHSQGEIAAAHV
AGALSLADAARLVVGRSRLLRSLSGGGGMSAVALGEAEVRRRLRSWEDRISVAAVNGPRS
VVVAGEPEALREWGREREAEGVRVREIDVDYASHSPQIDRVRDELLTVTGEIEPRSAEIT
FYSTVDVRAVDGTDLDAGYWYRNLRETVRFADAMTRLADSGYDAFVEVSPHPVVVSAVAE
AVEEAGVEDAVVVGTLSRGDGGPGAFLRSAATAHCAGVDVDWTPALPGAATIPLPTYPFQ
RKPYWLRSSAPAPASHDLAYRVSWTPITPPGDGVLDGDWLVVHPGGSTGWVDGLAAAITA
GGGRVVAHPVDSVTSRTGLAEALARRDGTFRGVLSWVATDERHVEAGAVALLTLAQALGD
AGIDAPLWCLTQEAVRTPVDGDLARPAQAALHGFAQVARLELARRFGGVLDLPATVDAAG
TRLVAAVLAGGGEDVVAVRGDRLYGRRLVRATLPPPGGGFTPHGTVLVTGAAGPVGGRLA
RWLAERGATRLVLPGAHPGEELLTAIRAAGATAVVCEPEAEALRTAIGGELPTALVHAET
LTNFAGVADADPEDFAATVAAKTALPTVLAEVLGDHRLEREVYCSSVAGVWGGVGMAAYA
AGSAYLDALVEHRRARGHASASVAWTPWALPGAVDDGRLRERGLRSLDVADALGTWERLL
RAGAVSVAVADVDWSVFTEGFAAIRPTPLFDELLDRRGDPDGAPVDRPGEPAGEWGRRIA
ALSPQEQRETLLTLVGETVAEVLGHETGTEINTRRAFSELGLDSLGSMALRQRLAARTGL
RMPASLVFDHPTVTALARYLRRLVVGDSDPTPVRVFGPTDEAEPVAVVGIGCRFPGGIAT
PEDLWRVVSEGTSITTGFPTDRGWDLRRLYHPDPDHPGTSYVDRGGFLDGAPDFDPGFFG
ITPREALAMDPQQRLTLEIAWEAVERAGIDPETLLGSDTGVFVGMNGQSYLQLLTGEGDR
LNGYQGLGNSASVLSGRVAYTFGWEGPALTVDTACSSSLVAIHLAMQSLRRGECSLALAG
GVTVMADPYTFVDFSAQRGLAADGRCKAFSAQADGFALAEGVAALVLEPLSKARRNGHQV
LAVLRGSAVNQDGASNGLAAPNGPSQERVIRQALTASGLRPADVDMVEAHGTGTELGDPI
EAGALIAAYGRDRDRPLWLGSVKTNIGHTQAAAGAAGVIKAVLAMRHGVLPRSLHADELS
PHIDWADGKVEVLREARQWPPGERPRRAGVSSFGVSGTNAHVIVEEAPAEPDPEPVPAAP
GGPLPFVLHGRSVQTVRSQARTLAEHLRTTGHRDLADTARTLATGRARFDVRAAVLGTDR
EGVCAALDALAQDRPSPDVVAPAVFAARTPVLVFPGQGSQWVGMARDLLDSSEVFAESMG
RCAEALSPYTDWDLLDVVRGVGDPDPYDRVDVLQPVLFAVMVSLARLWQSYGVTPGAVVG
HSQGEIAAAHVAGALSLADAARVVALRSRVLRELDDQGGMVSVGTSRAELDSVLRRWDGR
VAVAAVNGPGTLVVAGPTAELDEFLAVAEAREMRPRRIAVRYASHSPEVARVEQRLAAEL
GTVTAVGGTVPLYSTATGDLLDTTAMDAGYWYRNLRQPVLFEHAVRSLLERGFETFIEVS
PHPVLLMAVEETAEDAERPVTGVPTLRRDHDGPSEFLRNLLGAHVHGVDVDLRPAVAHGR
LVDLPTYPFDRQRLWPKPHRRADTSSLGVRDSTHPLLHAAVDVPGHGGAVFTGRLSPDEQ
QWLTQHVVGGRNLVPGSVLVDLALTAGADVGVPVLEELVLQQPLVLTAAGALLRLSVGAA
DEDGRRPVEIHAAEDVSDPAEARWSAYATGTLAVGVAGGGRDGTQWPPPGATALTLTDHY
DTLAELGYEYGPAFQALRAAWQHGDVVYAEVSLDAVEEGYAFDPVLLDAVAQTFGLTSRA
PGKLPFAWRGVTLHATGATAVRVVATPAGPDAVALRVTDPTGQLVATVDALVVRDAGADR
DQPRGRDGDLHRLEWVRLATPDPTPAAVVHVAADGLDDLLRAGGPAPQAVVVRYRPDGDD
PTAEARHGVLWAATLVRRWLDDDRWPATTLVVATSAGVEVSPGDDVPRPGAAAVWGVLRC
AQAESPDRFVLVDGDPETPPAVPDNPQLAVRDGAVFVPRLTPLAGPVPAVADRAYRLVPG
NGGSIEAVAFAPVPDADRPLAPEEVRVAVRATGVNFRDVLLALGMYPEPAEMGTEASGVV
TEVGSGVRRFTPGQAVTGLFQGAFGPVAVADHRLLTPVPDGWRAVDAAAVPIAFTTAHYA
LHDLAGLQAGQSVLVHAAAGGVGMAAVALARRAGAEVFATASPAKHPTLRALGLDDDHIA
SSRESGFGERFAARTGGRGVDVVLNSLTGDLLDESARLLADGGVFVEMGKTDLRPAEQFR
GRYVPFDLAEAGPDRLGEILEEVVGLLAAGALDRLPVSVWELSAAPAALTHMSRGRHVGK
LVLTQPAPVHPDGTVLVTGGTGTLGRLVARHLVTGHGVPHLLVASRRGPAAPGAAELRAD
VEGLGATIEIVACDTADREALAALLDSIPADRPLTGVVHTAGVLADGLVTSIDGTATDQV
LRAKVDAAWHLHDLTRDADLSFFVLFSSAASVLAGPGQGVYAAANGVLNALAGQRRALGL
PAKALGWGLWAQASEMTSGLGDRIARTGVAALPTERALALFDAALRSGGEVLFPLSVDRS
ALRRAEYVPEVLRGAVRSTPRAANRAETPGRGLLDRLVGAPETDQVAALAELVRSHAAAV
AGYDSADQLPERKAFKDLGFDSLAAVELRNRLGVTTGVRLPSTLVFDHPTPLAVAEHLRS
ELFADSAPDVGVGARLDDLERALDALPDAQGHADVGARLEALLRRWQSRRPPETEPVTIS
DDASDDELFSMLDRRLGGGGDV
selected fasta
>polyketide synthase [megalomicin 6-deoxyerythronolide B synthase 2]
GTGACTGACAACGACAAGGTGGCGGAGTACCTCCGTCGTGCGACGCTCGACCTGCGGGCC
GCCCGCAAGCGCCTGCGCGAGCTGCAATCCGACCCGATCGCGGTCGTCGGCATGGCCTGC
CGCCTACCGGGCGGGGTGCACCTCCCGCAGCACCTGTGGGACCTCCTGCGCCAGGGGCAC
GAGACGGTGTCCACCTTCCCCACCGGGCGCGGCTGGGACCTGGCCGGGCTCTTCCACCCG
GACCCCGACCACCCCGGCACCAGCTACGTCGACCGGGGTGGGTTCCTCGACGACGTGGCG
GGCTTCGACGCCGAGTTCTTCGGGATCTCCCCGCGCGAGGCCACGGCCATGGACCCGCAA
CAGCGGCTGCTGTTGGAGACCAGTTGGGAGCTGGTGGAGAGCGCCGGCATCGATCCGCAC
TCCCTGCGTGGCACCCCGACCGGCGTCTTCCTCGGCGTGGCGCGGCTCGGCTACGGCGAG
AACGGCACCGAAGCCGGTGACGCCGAGGGCTATTCGGTGACCGGGGTGGCACCCGCTGTC
GCCTCCGGGCGGATCTCCTACGCCCTCGGGCTGGAGGGTCCGTCGATCAGCGTGGACACC
GCGTGCTCGTCGTCGTTGGTGGCGCTGCACCTGGCGGTCGAGTCGCTGCGGCTGGGCGAG
TCGAGTCTCGCTGTCGTCGGCGGGGCGGCGGTCATGGCGACACCAGGGGTGTTCGTCGAC
TTCAGCCGCCAGCGGGCGTTGGCCGCTGACGGCAGGTCGAAGGCCTTCGGGGCCGCCGCC
GACGGGTTCGGCTTCTCCGAGGGGGTCTCCCTCGTCCTGCTCGAACGGCTCTCCGAGGCC
GAAAGCAACGGCCACGAGGTGTTGGCTGTCATCCGTGGCTCCGCCCTCAACCAGGACGGG
GCCAGCAACGGTCTCGCCGCGCCGAACGGGACCGCCCAGCGCAAGGTGATCCGGCAGGCG
CTACGAAACTGCGGCCTGACCCCGGCCGACGTGGACGCCGTGGAGGCGCACGGCACCGGC
ACCACGCTCGGCGACCCGATCGAGGCCAACGCCCTGCTGGACACCTACGGCCGTGACCGG
GATCCGGACCACCCGCTGTGGCTGGGGTCGGTGAAGTCGAACATCGGCCACACGCAGGCG
GCGGCGGGCGTCACCGGGCTGCTCAAGATGGTGCTGGCACTGCGCCACGAGGAACTGCCC
GCCACCCTGCACGTCGACGAGCCCACCCCGCACGTGGACTGGTCCTCGGGAGCGGTACGC
CTGGCGACCCGGGGCCGGCCGTGGCGGCGGGGTGACCGGCCGAGGCGGGCCGGGGTGTCG
GCGTTCGGCATCAGCGGGACCAACGCCCACGTGATCGTCGAGGAGGCACCCGAGCGGACC
ACCGAGCGCACCGTCGGCGGCGACGTCGGCCCGGTCCCGCTCGTGGTGTCCGCCCGGTCG
GCGGCGGCGCTACGGGCCCAGGCGGCCCAGGTCGCCGAGCTGGTGGAGGGCTCCGACGTC
GGGCTGGCGGAGGTCGGGCGGAGCCTGGCCGTGACCCGGGCGCGACACGAGCACCGGGCG
GCGGTGGTGGCGTCGACCCGGGCCGAGGCGGTGCGGGGGCTGCGCGAGGTCGCGGCGGTC
GAACCGCGCGGCGAGGACACCGTCACCGGGGTCGCCGAGACGTCCGGGCGCACCGTCGTC
TTCCTCTTCCCGGGACAGGGGTCCCAGTGGGTCGGGATGGGCGCGGAGCTGCTGGACTCG
GCACCGGCGTTCGCCGACACGATCCGCGCCTGCGACGAGGCGATGGCACCGTTGCAGGAC
TGGTCGGTCTCCGACGTGCTCCGGCAGGAGCCGGGGGCACCGGGACTGGACCGGGTCGAC
GTGGTGCAGCCGGTGCTGTTCGCGGTGATGGTGTCGTTGGCGCGGTTGTGGCAGTCGTAC
GGGGTCACCCCCGCTGCGGTGGTGGGGCACTCGCAGGGGGAGATCGCCGCCGCCCACGTG
GCGGGTGCGCTCTCCCTCGCCGACGCGGCGAGGCTGGTGGTGGGCCGCAGCCGGTTGCTG
CGGTCGCTGTCCGGGGGCGGCGGCATGAGCGCCGTCGCGCTCGGTGAGGCCGAGGTACGC
CGCCGACTGCGGTCGTGGGAGGACCGGATCTCCGTGGCCGCCGTCAACGGACCCCGGTCG
GTGGTGGTGGCCGGGGAACCGGAGGCGCTGCGGGAGTGGGGACGGGAGCGGGAGGCCGAG
GGCGTACGGGTCCGCGAGATCGACGTCGACTACGCCTCGCACTCGCCGCAGATCGACAGG
GTCCGTGACGAACTCCTGACGGTCACGGGGGAGATCGAGCCCCGGTCGGCGGAGATCACC
TTCTACTCGACGGTCGACGTCCGTGCTGTCGACGGCACCGACCTGGACGCGGGGTACTGG
TACCGCAACCTGCGGGAGACGGTCCGGTTCGCCGACGCGATGACCCGGTTGGCCGACTCG
GGATACGACGCGTTCGTCGAGGTCAGCCCGCATCCGGTGGTGGTGTCGGCGGTCGCCGAG
GCGGTCGAGGAGGCAGGTGTCGAGGACGCCGTCGTCGTCGGCACCCTGTCCCGGGGCGAC
GGCGGACCGGGGGCGTTCCTGCGGTCGGCGGCCACCGCCCACTGCGCCGGTGTGGACGTC
GACTGGACGCCCGCCCTCCCGGGAGCTGCGACGATCCCGTTGCCGACGTACCCGTTCCAA
CGGAAGCCGTACTGGCTGCGGTCGTCTGCTCCCGCCCCCGCCTCCCACGATCTCGCCTAC
CGGGTGTCCTGGACGCCGATCACCCCGCCCGGGGACGGCGTACTCGACGGCGACTGGCTG
GTGGTGCACCCCGGGGGCAGCACCGGATGGGTCGACGGGTTGGCGGCGGCGATCACCGCC
GGCGGTGGCCGGGTCGTCGCCCACCCGGTGGACTCCGTGACCTCCCGGACCGGCCTGGCC
GAGGCGCTCGCCCGGCGGGACGGCACGTTCCGGGGGGTGCTGTCGTGGGTGGCGACCGAC
GAACGGCACGTCGAGGCCGGTGCGGTCGCCCTGCTGACCCTGGCGCAGGCGTTGGGTGAC
GCCGGAATCGACGCACCACTGTGGTGCCTGACCCAGGAGGCGGTCCGTACCCCCGTCGAC
GGTGACCTGGCCCGACCGGCGCAGGCCGCCCTGCACGGTTTCGCCCAGGTCGCCCGGCTG
GAGCTGGCCCGCCGCTTCGGTGGGGTGCTCGACCTGCCCGCCACCGTCGACGCCGCCGGG
ACGCGTCTGGTCGCGGCGGTCCTCGCCGGCGGCGGCGAGGACGTCGTCGCCGTCCGTGGC
GACCGTCTCTACGGCCGTCGCCTGGTCAGGGCGACCCTGCCGCCGCCCGGCGGGGGGTTC
ACCCCGCACGGCACCGTCCTGGTCACCGGCGCGGCCGGTCCGGTGGGCGGTCGGCTGGCC
CGGTGGCTCGCCGAACGGGGTGCCACCCGACTCGTCCTGCCCGGCGCACACCCGGGCGAG
GAGTTGCTGACCGCGATCCGGGCCGCCGGTGCCACCGCCGTGGTGTGCGAACCGGAGGCG
GAGGCACTGCGTACGGCGATCGGCGGGGAGTTGCCGACCGCGCTCGTACACGCCGAGACG
TTGACGAACTTCGCCGGCGTCGCCGACGCCGACCCCGAGGACTTCGCCGCCACCGTCGCG
GCGAAGACCGCGCTGCCGACGGTCCTGGCGGAGGTGCTCGGCGACCACCGCCTCGAACGG
GAGGTCTACTGCTCGTCGGTGGCCGGGGTCTGGGGTGGGGTCGGCATGGCCGCGTACGCC
GCCGGCAGCGCCTACCTCGACGCCCTGGTCGAGCACCGTCGCGCCCGGGGGCACGCCAGC
GCCTCGGTGGCCTGGACCCCGTGGGCCCTGCCCGGCGCGGTCGACGACGGTCGGCTGCGC
GAGCGCGGCCTGCGCAGCCTCGACGTGGCCGACGCCCTCGGGACGTGGGAACGTCTGCTC
CGCGCCGGTGCGGTGTCGGTGGCCGTCGCCGACGTCGACTGGTCGGTCTTCACAGAGGGT
TTCGCGGCCATCCGGCCGACCCCGCTCTTCGACGAACTCCTCGACCGGCGCGGGGACCCC
GACGGCGCGCCCGTCGACCGGCCGGGGGAGCCGGCGGGCGAGTGGGGTCGACGAATCGCG
GCGCTGTCCCCGCAGGAACAGCGGGAGACGTTGCTGACCCTCGTCGGCGAGACGGTCGCG
GAGGTGCTGGGACACGAGACCGGCACCGAGATCAACACCCGTCGGGCCTTCAGCGAACTC
GGCCTCGACTCGCTGGGCTCGATGGCCCTGCGTCAGCGCCTGGCGGCCCGTACCGGCCTG
CGGATGCCGGCCTCGCTGGTCTTCGACCACCCGACGGTCACCGCGCTCGCGCGGTACCTG
CGTCGACTGGTCGTCGGGGACTCCGACCCGACCCCGGTACGGGTGTTCGGCCCCACCGAC
GAGGCCGAACCCGTCGCCGTGGTCGGCATCGGCTGCCGGTTCCCCGGCGGCATCGCCACC
CCCGAGGACCTCTGGCGGGTGGTGTCCGAGGGCACCTCCATCACCACCGGATTCCCCACC
GACCGGGGCTGGGACCTCCGGCGGCTCTACCACCCCGACCCGGACCACCCCGGCACCAGC
TACGTCGACAGGGGGGGATTCCTCGACGGGGCCCCGGACTTCGACCCCGGGTTCTTCGGG
ATCACCCCCCGCGAGGCGCTGGCGATGGACCCGCAGCAGCGGCTCACCCTGGAGATCGCG
TGGGAGGCGGTGGAACGGGCGGGCATCGACCCGGAGACCCTCCTCGGCAGCGACACCGGC
GTCTTCGTCGGCATGAACGGCCAGTCCTACCTGCAACTGCTGACCGGGGAGGGTGACCGG
CTCAACGGCTACCAGGGGTTGGGCAACTCGGCGAGCGTGCTCTCCGGCCGTGTCGCCTAC
ACCTTCGGGTGGGAGGGGCCGGCGCTGACGGTGGACACCGCCTGCTCGTCCTCGCTGGTC
GCCATCCACCTCGCCATGCAGTCGCTGCGTCGGGGTGAGTGCTCGCTGGCGTTGGCCGGC
GGGGTGACGGTCATGGCCGACCCGTACACCTTCGTGGACTTCAGCGCACAGCGGGGGCTC
GCCGCCGACGGGCGGTGCAAGGCGTTCTCCGCGCAGGCCGACGGGTTCGCCCTCGCCGAG
GGCGTCGCGGCGCTCGTCCTCGAACCGTTGTCCAAGGCGCGGCGAAACGGCCACCAGGTG
CTGGCGGTGCTGCGCGGCAGCGCCGTCAACCAGGACGGGGCCAGCAACGGCCTCGCCGCC
CCGAACGGGCCGTCGCAGGAACGGGTGATCAGGCAGGCCCTGACCGCCTCCGGGCTGCGT
CCCGCCGACGTCGACATGGTGGAGGCGCACGGGACGGGCACCGAACTCGGCGACCCGATC
GAGGCCGGGGCGCTCATCGCGGCGTACGGCCGGGACCGGGACCGGCCGCTCTGGCTGGGC
TCGGTGAAGACGAACATCGGCCACACCCAGGCCGCCGCCGGTGCCGCCGGGGTGATCAAG
GCGGTCCTGGCGATGCGGCACGGCGTACTCCCGAGGTCGCTGCACGCCGACGAGTTGTCC
CCGCACATCGACTGGGCGGACGGGAAGGTCGAGGTGCTCCGCGAGGCACGACAGTGGCCC
CCCGGTGAGCGCCCCCGCCGCGCCGGGGTGTCCTCCTTCGGCGTCAGCGGGACCAACGCC
CACGTCATCGTCGAGGAGGCACCCGCCGAACCGGACCCCGAACCGGTTCCCGCCGCCCCG
GGCGGGCCCCTGCCCTTCGTCCTGCACGGACGCAGCGTCCAGACGGTCCGGTCCCAGGCG
CGGACCCTCGCCGAACACCTGCGCACCACCGGCCACCGGGACCTCGCCGACACCGCCCGT
ACCCTGGCCACCGGTCGCGCCCGTTTCGACGTCCGGGCCGCAGTGCTCGGCACCGACCGG
GAGGGTGTCTGCGCCGCCCTCGACGCGCTGGCGCAGGATCGCCCCTCGCCCGACGTCGTC
GCCCCGGCGGTCTTCGCCGCCCGTACCCCCGTCCTGGTCTTCCCCGGGCAGGGGTCGCAG
TGGGTCGGCATGGCCCGTGACCTGCTCGACTCCTCCGAGGTGTTCGCCGAGTCGATGGGC
CGGTGCGCCGAGGCGCTGTCGCCGTACACCGACTGGGACCTGCTCGACGTGGTCCGTGGG
GTCGGCGACCCCGACCCGTACGACCGGGTGGACGTGCTCCAGCCGGTGCTGTTCGCGGTG
ATGGTGTCGCTGGCGCGGTTGTGGCAGTCGTACGGGGTGACTCCGGGTGCGGTGGTGGGT
CACTCGCAGGGGGAGATCGCCGCCGCGCACGTGGCTGGTGCGTTGTCGTTGGCCGACGCC
GCCAGGGTGGTGGCGTTGCGCAGCCGGGTGCTGCGGGAGCTCGACGACCAGGGCGGCATG
GTGTCGGTCGGCACCTCCCGCGCCGAGTTGGACTCGGTCCTGCGCCGGTGGGACGGGCGG
GTCGCGGTGGCGGCGGTGAACGGACCCGGCACGCTCGTGGTGGCCGGACCCACCGCCGAA
CTGGACGAGTTCCTCGCGGTGGCCGAGGCCCGCGAGATGAGGCCGCGTCGGATCGCGGTG
CGCTACGCGTCGCACTCCCCGGAGGTGGCCCGGGTCGAACAGCGGCTCGCCGCCGAACTC
GGCACCGTCACCGCCGTCGGCGGCACGGTCCCGCTCTACTCCACCGCCACCGGGGACCTC
CTCGACACCACAGCCATGGACGCCGGGTACTGGTACCGCAACCTGCGCCAACCGGTGCTG
TTCGAGCACGCCGTCCGCAGCCTCCTGGAGCGGGGATTCGAGACGTTCATCGAGGTCAGC
CCGCACCCTGTGCTGCTGATGGCGGTCGAGGAGACCGCCGAGGACGCCGAGCGCCCGGTC
ACCGGCGTGCCGACGCTGCGCCGCGACCACGACGGGCCGTCGGAGTTCCTCCGCAACCTC
CTGGGGGCGCACGTGCACGGGGTCGACGTCGACCTGCGTCCGGCGGTCGCCCACGGCCGC
CTGGTCGACCTGCCCACCTACCCCTTCGACAGGCAGCGGCTCTGGCCCAAGCCGCACCGC
AGGGCCGACACCTCGTCGCTGGGGGTCCGTGACTCGACCCACCCGCTGCTGCACGCCGCA
GTCGACGTACCCGGTCACGGCGGAGCGGTGTTCACCGGGCGGCTCTCCCCCGACGAGCAG
CAGTGGCTGACCCAGCACGTGGTGGGTGGGCGGAACCTGGTGCCCGGCAGTGTCCTGGTC
GACCTCGCGCTCACCGCCGGGGCCGACGTCGGCGTGCCGGTGCTGGAGGAACTCGTCCTG
CAGCAGCCGCTGGTGTTGACCGCCGCCGGTGCGTTGCTGCGCCTGTCGGTCGGCGCCGCC
GACGAGGACGGGCGGCGGCCGGTCGAGATCCACGCCGCCGAGGACGTCTCCGACCCGGCC
GAGGCCCGGTGGTCGGCGTACGCGACCGGGACCCTCGCCGTCGGCGTGGCCGGCGGCGGC
CGGGACGGCACACAGTGGCCCCCGCCCGGCGCCACCGCCCTGACGTTGACCGACCACTAC
GACACCCTCGCCGAACTGGGCTACGAGTACGGGCCGGCGTTCCAGGCGCTGCGCGCCGCG
TGGCAGCACGGCGACGTGGTCTACGCGGAGGTGTCCCTCGACGCCGTCGAGGAGGGGTAC
GCGTTCGACCCGGTGCTGCTCGACGCCGTCGCCCAGACCTTCGGCCTGACCAGTCGCGCC
CCCGGGAAGCTCCCCTTCGCCTGGCGGGGCGTCACCCTGCACGCCACCGGGGCCACTGCG
GTACGGGTGGTGGCGACCCCCGCCGGACCGGACGCGGTGGCCCTGCGGGTCACCGACCCG
ACCGGTCAGCTCGTCGCCACGGTGGACGCCCTGGTCGTCAGGGACGCCGGGGCGGATCGG
GACCAGCCGCGCGGCCGCGACGGCGACCTGCACCGCCTGGAGTGGGTACGGCTGGCCACC
CCGGACCCGACCCCGGCGGCGGTGGTGCACGTGGCGGCCGACGGGCTCGACGACCTGCTG
CGCGCCGGTGGTCCGGCACCACAGGCCGTCGTCGTCCGCTACCGTCCCGACGGCGACGAC
CCGACGGCCGAGGCCCGTCACGGGGTGCTCTGGGCGGCCACGCTCGTGCGCCGTTGGCTC
GACGACGACCGGTGGCCCGCCACCACCCTGGTGGTGGCCACGTCCGCAGGGGTCGAGGTC
TCCCCCGGGGACGACGTGCCGCGCCCCGGGGCCGCCGCCGTGTGGGGGGTGCTGCGCTGC
GCCCAGGCGGAGTCCCCGGACCGCTTCGTGCTCGTCGACGGCGACCCGGAGACGCCCCCG
GCGGTGCCGGACAATCCGCAGCTCGCGGTCCGTGACGGTGCGGTGTTCGTGCCACGGCTG
ACGCCGCTCGCCGGTCCCGTGCCGGCCGTCGCCGACCGGGCGTACCGGCTGGTGCCCGGC
AACGGCGGCTCCATCGAGGCAGTGGCCTTCGCCCCCGTCCCCGACGCCGACCGGCCCCTG
GCGCCGGAGGAGGTACGCGTCGCCGTCCGCGCCACCGGCGTGAACTTCCGTGACGTCCTG
CTCGCGCTCGGCATGTACCCGGAACCGGCCGAGATGGGCACCGAGGCGTCCGGTGTGGTC
ACCGAGGTCGGGTCGGGTGTCCGGCGGTTCACCCCCGGCCAGGCGGTGACGGGCCTGTTC
CAGGGGGCCTTCGGGCCGGTGGCGGTCGCCGACCACCGGCTCCTCACCCCGGTCCCCGAC
GGGTGGCGGGCGGTGGACGCCGCAGCCGTACCCATCGCGTTCACCACCGCCCACTACGCG
CTGCACGACCTGGCCGGGTTGCAGGCCGGGCAGTCCGTGCTGGTCCACGCCGCCGCCGGC
GGGGTGGGGATGGCTGCCGTCGCGTTGGCCCGTCGGGCCGGGGCGGAGGTGTTCGCCACG
GCCAGCCCGGCCAAACACCCGACGCTGCGGGCGCTCGGCCTCGACGACGACCACATCGCC
TCGTCCCGGGAGAGCGGGTTCGGTGAGCGGTTCGCCGCGCGTACCGGGGGGCGGGGCGTC
GACGTGGTCCTGAACTCGCTCACCGGCGACCTGCTCGACGAGTCCGCGCGGCTGCTCGCC
GACGGCGGGGTCTTCGTCGAGATGGGCAAGACCGACCTGCGGCCGGCGGAGCAGTTCCGG
GGCCGGTACGTCCCGTTCGACCTGGCCGAGGCCGGTCCCGATCGGCTCGGCGAGATCCTG
GAGGAGGTCGTCGGTCTGCTGGCCGCCGGTGCCCTCGACCGGTTGCCGGTGTCGGTGTGG
GAGTTGTCGGCGGCCCCGGCCGCGCTCACCCACATGAGCCGGGGCCGACACGTGGGCAAG
CTCGTCCTCACCCAGCCCGCCCCCGTGCACCCCGACGGAACGGTGCTGGTCACCGGCGGG
ACCGGCACCCTGGGGCGGCTGGTCGCCCGCCACCTGGTGACCGGGCACGGCGTACCCCAC
CTCCTGGTGGCCAGCCGGCGCGGTCCGGCGGCCCCGGGCGCGGCCGAGCTGCGCGCCGAC
GTCGAAGGCCTCGGCGCGACCATCGAGATCGTCGCCTGCGACACCGCCGACCGGGAGGCG
CTCGCGGCGCTGCTCGACTCGATCCCCGCGGACCGTCCGCTGACCGGGGTGGTGCACACC
GCCGGGGTCCTGGCCGACGGGCTGGTCACCTCCATCGACGGGACCGCCACCGATCAGGTC
CTGCGGGCCAAGGTCGACGCGGCGTGGCACCTGCACGACCTGACCCGGGACGCGGACCTG
AGCTTCTTCGTGCTGTTCTCGTCGGCGGCGTCGGTGCTGGCCGGTCCCGGGCAGGGCGTG
TACGCGGCGGCCAACGGGGTCCTCAACGCCCTGGCCGGGCAACGGCGGGCCCTCGGACTG
CCCGCGAAGGCGCTCGGGTGGGGCCTGTGGGCGCAGGCCAGCGAGATGACCAGCGGCCTC
GGTGACCGGATCGCCCGTACCGGGGTCGCCGCGCTGCCGACCGAGCGGGCGCTGGCCCTG
TTCGACGCGGCTCTGCGCAGCGGCGGGGAGGTGCTGTTCCCGCTGTCTGTCGACAGGTCG
GCGCTGCGCCGGGCCGAGTACGTCCCCGAGGTGCTGCGCGGCGCGGTCCGGTCCACGCCA
CGGGCCGCCAACAGGGCCGAGACCCCGGGCCGGGGCCTGCTCGACCGTCTCGTCGGTGCA
CCCGAGACCGATCAGGTGGCCGCGCTGGCCGAGCTGGTCCGCTCGCACGCGGCGGCGGTC
GCCGGCTACGACTCGGCCGACCAGCTGCCCGAACGCAAGGCGTTCAAGGACCTCGGGTTC
GACTCGCTGGCGGCGGTGGAGCTGCGCAACCGGCTCGGCGTCACCACCGGCGTACGGCTG
CCCAGCACGCTGGTGTTCGACCACCCGACACCGCTGGCGGTGGCCGAACACCTGCGGTCG
GAGTTGTTCGCCGACTCCGCGCCGGACGTCGGGGTCGGTGCGCGCCTCGACGACCTGGAA
CGGGCGCTCGACGCCCTGCCCGACGCGCAGGGACACGCCGACGTCGGGGCCCGCCTGGAG
GCGCTGCTGCGCCGGTGGCAGAGCCGACGACCCCCGGAGACCGAGCCAGTGACGATCAGT
GACGACGCCAGTGACGACGAGCTGTTCTCGATGCTCGACAGGCGTCTCGGCGGGGGAGGG
GACGTCTAG
[3] KS31..406
[3] AT560..880
[3] methylmalonyl-CoA751..755
[3] kr1124..1291
[3] ACP1391..1461
[4] KS1483..1856
[4] AT2011..2330
[4] methylmalonyl-CoA2202..2206
[4] DH2374..2537
[4] ER2823..3123
[4] KR3133..3313
[4] ACP3409..3479
[3] KS91..1218
[3] AT1678..2640
[3] methylmalonyl-CoA2251..2265
[3] kr3370..3873
[3] ACP4171..4383
[4] KS4447..5568
[4] AT6031..6990
[4] methylmalonyl-CoA6604..6618
[4] DH7120..7611
[4] ER8467..9369
[4] KR9397..9939
[4] ACP10225..10437

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [551-683]  G3DSA:3.40.366.10 [751-868]  G3DSA:3.40.366.10 [2010-2134]  G3DSA:3.40.366.10 [2202-2318]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1124-1277]  2.2e-29 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1419-1434]  PS00012 [3437-3452]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1384-1499]  2.19999900980708e-25 SSF47336 [3401-3496]  1e-20 SSF47336
SSF47336   ACP_like
 [1391-1461]  PS50075 [3409-3479]  PS50075
PS50075   ACP_DOMAIN
 [1388-1463]  8.89999999999994e-41 G3DSA:1.10.1200.10 [3408-3482]  8.89999999999994e-41 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1397-1460]  1.9e-11 PF00550 [3412-3478]  4.40000000000001e-10 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [2811-2957]  6.19998763505952e-30 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [2961-3063]  8.19999999999997e-18 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2842-2897]  7.59999999999999e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [3133-3312]  6.29999999999998e-56 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [31-280]  8.29999999999993e-93 PF00109 [1483-1733]  2.39999999999997e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [288-406]  1.5e-46 PF02801 [1741-1856]  1.29999999999998e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [560-880]  5.00000000000001e-118 PF00698 [2011-2330]  1.29999999999998e-114 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  1.1e-06 PF08990
PF08990   Docking
IPR015357 Erythronolide synthase, docking (Domain)
 [3486-3542]  2.70000000000002e-33 PF09277
PF09277   Erythro-docking
 [3483-3542]  7.69998480533694e-29 SSF101166
SSF101166   Erythronolide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [558-847]  2.89997807423186e-68 SSF52151 [2009-2321]  5.10003242202156e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [685-750]  3.89999861795218e-18 SSF55048 [2136-2201]  3.0999994589937e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-292]  G3DSA:3.40.47.10 [293-459]  G3DSA:3.40.47.10 [1485-1745]  G3DSA:3.40.47.10 [1746-1910]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [23-458]  5.29997329885557e-98 SSF53901 [1475-1855]  4.20003460493095e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1124-1293]  2.50000000000001e-42 G3DSA:3.40.50.720 [2957-3051]  7.5e-20 G3DSA:3.40.50.720 [3133-3312]  4.39999999999997e-47 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [193-209]  PS00606 [1646-1662]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [562-860]  5.29997329885557e-124 SM00827 [2013-2310]  3.39999972437719e-111 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1392-1464]  6.50000805230168e-28 SM00823 [3410-3482]  7.40000780398343e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2374-2537]  1.40000506907309e-64 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [33-458]  SM00825 [1485-1909]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1124-1291]  9.59999914716171e-18 SM00822 [3133-3313]  1.10000150671643e-50 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [2823-3123]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit