close all open/close all

CDS information : Megalo_00140


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction33,666 / 43,271 / + [in whole cluster]
33,666 / 43,271 / + [in contig]
Location33666..43271 [in whole cluster]
33666..43271 [in contig]
TypeCDS
Length9,606 bp (3,201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)megalomicin 6-deoxyerythronolide B synthase 3
Gene
Gene (GenBank)megAIII
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[15595843] Identification of domains within megalomicin and erythromycin polyketide synthase modules responsible for differences in polyketide production levels in Escherichia coli. (Biochemistry. , 2004)

close this sectionPKS/NRPS Module

5 methylmalonyl-CoA
6 methylmalonyl-CoA
KS39..403
AT574..893
KR1137..1315
ACP1412..1482
KS1507..1878
AT2044..2356
KR2583..2759
ACP2847..2917
TE2989..3196

close this sectionSequence

selected fasta
>polyketide synthase [megalomicin 6-deoxyerythronolide B synthase 3]
MSESSGMTEDRLRRYLKRTVAELDSVTGRLDEVEYRAREPIAVVGMACRFPGGVDSPEAF
WEFIRDGGDAIAEAPTDRGWPPAPRPRLGGLLAEPGAFDAAFFGISPREALATDPQQRLM
LEISWEALERAGFDPSSLRGSAGGVFTGVGAVDYGPRPDEAPEEVLGYVGIGTASSVASG
RVAYTLGLEGPAVTVDTACSSGLTAVHLAMESLRRDECTLVLAGGVTVMSSPGAFTEFRS
QGGLAEDGRCKPFSRAADGFGLAEGAGVLVLQRLSVARAEGRPVLAVLRGSAINQDGASN
GLTAPSGPAQRRVIRQALERARLRPVDVDYVEAHGTGTRLGDPIEAHALLDTYGADREPG
RPLWVGSVKSNIGHTQAAAGVAGVMKTVLALRHREIPATLHFDEPSPHVDWDRGAVSVVS
ETRPWPVGERPRRAGVSSFGISGTNAHVIVEEAPSPQAADLDPTPGPATGATPGTDAAPT
AEPGAEAVALVFSARDERALRAQAARLADRLTDDPAPSLRDTAFTLVTRRATWEHRAVVV
GGGEEVLAGLRAVAGGRPVDGAVSGRARAGRRVVLVFPGQGAQWQGMARDLLRQSPTFAE
SIDACERALAPHVDWSLREVLDGEQSLDPVDVVQPVLFAVMVSLARLWQSYGVTPGAVVG
HSQGEIAAAHVAGALSLADAARVVALRSRVLRRLGGHGGMASFGLHPDQAAERIARFAGA
LTVASVNGPRSVVLAGENGPLDELIAECEAEGVTARRIPVDYASHSPQVESLREELLAAL
AGVRPVSAGIPLYSTLTGQVIETATMDADYWFANLREPVRFQDATRQLAEAGFDAFVEVS
PHPVLTVGVEATLEAVLPPDADPCVTGTLRRERGGLAQFHTALAEAYTRGVEVDWRTAVG
EGRPVDLPVYPFQRQNFWLPVPLGRVPDTGDEWRYQLAWHPVDLGRSSLAGRVLVVTGAA
VPPAWTDVVRDGLEQRGATVVLCTAQSRARIGAALDAVDGTALSTVVSLLALAEGGAVDD
PSLDTLALVQALGAAGIDVPLWLVTRDAAAVTVGDDVDPAQAMVGGLGRVVGVESPARWG
GLVDLREADADSARSLAAILADPRGEEQFAIRPDGVTVARLVPAPARAAGTRWTPRGTVL
VTGGTGGIGAHLARWLAGAGAEHLVLLNRRGAEAAGAADLRDELVALGTGVTITACDVAD
RDRLAAVLDAARAQGRVVTAVFHAAGISRSTAVQELTESEFTEITDAKVRGTANLAELCP
ELDALVLFSSNAAVWGSPGLASYAAGNAFLDAFARRGRRSGLPVTSIAWGLWAGQNMAGT
EGGDYLRSQGLRAMDPQRAIEELRTTLDAGDPWVSVVDLDRERFVELFTAARRRPLFDEL
GGVRAGAEETGQESDLARRLASMPEAERHEHVARLVRAEVAAVLGHGTPTVIERDVAFRD
LGFDSMTAVDLRNRLAAVTGVRVATTIVFDHPTVDRLTAHYLERLVGEPEATTPAAAVVP
QAPGEADEPIAIVGMACRLAGGVRTPDQLWDFIVADGDAVTEMPSDRSWDLDALFDPDPE
RHGTSYSRHGAFLDGAADFDAAFFGISPREALAMDPQQRQVLETTWELFENAGIDPHSLR
GTDTGVFLGAAYQGYGQNAQVPKESEGYLLTGGSSAVASGRIAYVLGLEGPAITVDTACS
SSLVALHVAAGSLRSGDCGLAVAGGVSVMAGPEVFTEFSRQGALAPDGRCKPFSDQADGF
GFAEGVAVVLLQRLSVAVREGRRVLGVVVGSAVNQDGASNGLAAPSGVAQQRVIRRAWGR
AGVSGGDVGVVEAHGTGTRLGDPVELGALLGTYGVGRGGVGPVVVGSVKANVGHVQAAAG
VVGVIKVVLGLGRGLVGPMVCRGGLSGLVDWSSGGLVVADGVRGWPVGVDGVRRGGVSAF
GVSGTNAHVVVAEAPGSVVGAERPVEGSSRGLVGVAGGVVPVVLSAKTETALTELARRLH
DAVDDTVALPAVAATLATGRAHLPYRAALLARDHDELRDRLRAFTTGSAAPGVVSGVASG
GGVVFVFPGQGGQWVGMARGLLSVPVFVESVVECDAVVSSVVGFSVLGVLEGRSGAPSLD
RVDVVQPVLFVVMVSLARLWRWCGVVPAAVVGHSQGEIAAAVVAGVLSVGDGARVVALRA
RALRALAGHGGMVSLAVSAERARELIAPWSDRISVAAVNSPTSVVVSGDPQALAALVAHC
AETGERAKTLPVDYASHSAHVEQIRDTILTDLADVTARRPDVALYSTLHGARGAGTDMDA
RYWYDNLRSPVRFDEAVEAAVADGYRVFVEMSPHPVLTAAVQEIDDETVAIGSLHRDTGE
RHLVAELARAHVHGVPVDWRAILPATHPVPLPNYPFEATRYWLAPTAADQVADHRYRVDW
RPLATTPAELSGSYLVFGDAPETLGHSVEKAGGLLVPVAAPDRESLAVALDEAAGRLAGV
LSFAADTATHLARHRLLGEADVEAPLWLVTSGGVALDDHDPIDCDQAMVWGIGRVMGLET
PHRWGGLVDVTVEPTAEDGVVFAALLAADDHEDQVALRDGIRHGRRLVRAPLTTRNARWT
PAGTALVTGGTGALGGHVARYLARSGVTDLVLLSRSGPDAPGAAELAAELADLGAEPRVE
ACDVTDGPRLRALVQELREQDRPVRIVVHTAGVPDSRPLDRIDELESVSAAKVTGARLLD
ELCPDADTFVLFSSGAGVWGSANLGAYAAANAYLDALAHRRRQAGRAATSVAWGAWAGDG
MATGDLDGLTRRGLRAMAPDRALRACTRRWTTHDTCVSVADVDWDRFAVGFTAARPRPLI
DELVTSAPVAAPTAAAAPVPAMTADQLLQFTRSHVAAILGHQDPDAVGLDQPFTELGFDS
LTAVGLRNQLQQATGRTLPAALVFQHPTVRRLADHLAQQLDVGTAPVEATGSVLRDGYRR
AGQTGDVRSYLDLLANLSEFRERFTDAASLGGQLELVDLADGSGPVTVICCAGTAALSGP
HEFARLASALRGTVPVRALAQPGYEAGEPVPASMEAVLGVQADAVLAAQGDTPFVLVGHS
AGALMAYALATELADRGHPPRGVVLLDVYPPGHQEAVHAWLGELTAALFDHETVRMDDTR
LTALGAYDRLTGRWRPRDTGLPTLVVAASEPMGEWPDDGWQSTWPFGHDRVTVPGDHFSM
VQEHADAIARHIDAWLSGERA
selected fasta
>polyketide synthase [megalomicin 6-deoxyerythronolide B synthase 3]
ATGAGCGAGAGCAGCGGCATGACCGAGGACCGCCTCCGGCGCTATCTCAAGCGCACCGTC
GCCGAACTCGACTCGGTGACAGGTCGGCTCGACGAGGTCGAGTACCGGGCCCGCGAACCG
ATCGCCGTCGTCGGCATGGCCTGCCGGTTCCCCGGGGGTGTGGACTCGCCGGAGGCGTTC
TGGGAGTTCATCCGCGACGGTGGTGACGCGATCGCCGAGGCGCCCACGGACCGTGGCTGG
CCGCCGGCACCGCGACCCCGCCTCGGTGGTCTCCTCGCGGAGCCGGGCGCGTTCGACGCC
GCCTTCTTCGGCATCTCACCCCGCGAGGCGCTCGCGACGGACCCCCAGCAGCGCCTGATG
CTGGAGATCTCCTGGGAGGCGTTGGAGCGTGCGGGTTTCGACCCGTCGAGCCTGCGCGGC
AGCGCCGGTGGCGTCTTCACCGGTGTCGGTGCGGTGGACTACGGACCCAGGCCGGACGAG
GCACCCGAGGAGGTGCTCGGCTACGTCGGCATCGGCACCGCCTCCAGCGTCGCCTCCGGA
CGGGTGGCGTACACCCTGGGGTTGGAGGGTCCAGCCGTCACCGTCGACACCGCCTGCTCC
TCCGGGCTCACCGCGGTGCACCTGGCGATGGAGTCGCTGCGCCGCGACGAGTGCACCCTG
GTCCTCGCCGGTGGGGTCACCGTGATGAGCAGCCCGGGTGCGTTCACCGAGTTCCGCAGC
CAGGGCGGGTTGGCCGAGGACGGCCGCTGCAAACCGTTCTCCCGCGCCGCCGACGGCTTC
GGGCTCGCCGAGGGGGCCGGGGTCCTGGTGCTCCAACGGCTGTCCGTCGCCCGGGCCGAG
GGCCGGCCGGTGCTGGCCGTACTGCGTGGCTCGGCGATCAACCAGGACGGTGCCAGCAAC
GGGCTCACCGCGCCGAGCGGCCCCGCCCAGCGGCGGGTGATCAGGCAGGCGTTGGAGCGG
GCGCGGCTGCGTCCCGTCGACGTGGACTACGTGGAGGCCCACGGCACCGGCACCCGGCTG
GGCGATCCGATCGAGGCGCACGCCCTGCTCGACACGTACGGTGCCGACCGGGAACCCGGC
CGCCCGCTCTGGGTCGGATCGGTGAAGTCCAACATCGGTCACACCCAGGCGGCGGCGGGG
GTGGCCGGGGTGATGAAGACCGTGCTGGCGCTGCGGCATCGGGAGATCCCGGCGACGTTG
CACTTCGACGAGCCCTCGCCGCACGTCGACTGGGACCGGGGTGCGGTGTCGGTGGTGTCC
GAGACCCGGCCCTGGCCGGTGGGGGAGCGCCCGCGCCGGGCGGGGGTGTCCTCGTTCGGC
ATCAGCGGCACCAACGCGCACGTCATCGTCGAGGAGGCGCCGAGCCCGCAGGCGGCCGAC
CTCGACCCGACCCCCGGCCCGGCAACCGGAGCGACCCCCGGAACGGATGCCGCCCCCACC
GCCGAGCCGGGTGCGGAGGCGGTCGCACTGGTGTTCTCCGCGCGCGACGAGCGGGCCCTG
CGCGCCCAGGCGGCCCGGCTCGCCGACCGTCTCACCGACGACCCGGCCCCCTCGTTGCGC
GACACCGCCTTCACCCTGGTCACCCGCCGTGCCACCTGGGAGCATCGGGCGGTCGTCGTC
GGCGGGGGCGAGGAGGTCCTCGCCGGCCTCCGGGCCGTCGCCGGGGGACGTCCCGTCGAC
GGAGCCGTCAGCGGGCGGGCGCGCGCCGGCCGCCGGGTGGTGCTGGTCTTCCCCGGGCAG
GGCGCACAGTGGCAGGGCATGGCCCGGGACCTGCTGCGGCAGTCGCCGACCTTCGCGGAG
TCCATCGACGCCTGCGAGCGGGCGCTCGCCCCGCACGTGGACTGGTCGCTGCGCGAGGTG
CTCGACGGCGAGCAGTCGTTGGACCCCGTCGACGTGGTGCAGCCGGTGCTGTTCGCGGTG
ATGGTGTCGTTGGCGCGGTTGTGGCAGTCGTACGGGGTGACTCCGGGTGCGGTGGTGGGT
CACTCGCAGGGGGAGATCGCCGCCGCGCACGTGGCTGGTGCGTTGTCGTTGGCCGACGCC
GCCAGGGTGGTGGCGTTGCGCAGCCGGGTGCTGCGCCGTCTCGGTGGTCACGGCGGGATG
GCGTCGTTCGGGCTCCACCCCGACCAGGCCGCCGAGCGGATCGCGCGCTTCGCGGGTGCG
CTGACTGTCGCCTCGGTCAACGGTCCCCGTTCGGTGGTGCTGGCCGGGGAGAACGGCCCG
TTGGACGAGCTGATCGCCGAGTGCGAGGCCGAGGGCGTGACCGCCCGTCGGATCCCCGTC
GACTACGCCTCACACTCCCCGCAGGTGGAGTCGCTGCGTGAGGAGCTGCTCGCCGCACTG
GCCGGGGTCCGTCCGGTGTCGGCCGGGATCCCCCTGTACTCGACCCTGACCGGTCAGGTC
ATCGAAACGGCGACGATGGACGCCGACTACTGGTTCGCCAACCTCCGGGAGCCGGTGCGC
TTCCAGGACGCCACCAGGCAGCTCGCCGAGGCGGGGTTCGACGCCTTCGTCGAGGTCAGC
CCGCACCCGGTGTTGACAGTCGGTGTCGAGGCCACCCTCGAGGCAGTGCTGCCCCCCGAC
GCGGATCCGTGTGTCACAGGCACCCTGCGCCGCGAACGCGGCGGTCTCGCGCAGTTCCAC
ACCGCGCTCGCCGAGGCGTACACCCGGGGGGTGGAGGTCGACTGGCGTACCGCAGTGGGT
GAGGGACGCCCGGTCGACCTGCCGGTCTACCCGTTCCAACGACAGAACTTCTGGCTCCCG
GTCCCCCTGGGCCGGGTCCCCGACACCGGCGACGAGTGGCGTTACCAGCTCGCCTGGCAC
CCCGTCGACCTCGGGCGGTCCTCCCTGGCCGGACGGGTCCTGGTGGTGACCGGAGCGGCA
GTACCCCCGGCCTGGACGGACGTGGTCCGCGACGGCCTGGAACAGCGCGGGGCGACCGTC
GTGTTGTGCACCGCGCAGTCGCGCGCCCGGATCGGCGCCGCACTCGACGCCGTCGACGGC
ACCGCCCTGTCCACTGTGGTCTCTCTGCTCGCGCTCGCCGAGGGCGGTGCTGTCGACGAC
CCCAGCCTGGACACCCTCGCGTTGGTCCAGGCGCTCGGCGCAGCCGGGATCGACGTCCCC
CTGTGGCTGGTGACCAGGGACGCCGCCGCCGTGACCGTCGGAGACGACGTCGATCCGGCC
CAGGCCATGGTCGGTGGGCTCGGCCGGGTGGTGGGCGTGGAGTCCCCCGCCCGGTGGGGT
GGCCTGGTGGACCTGCGCGAGGCCGACGCCGACTCGGCCCGGTCGCTGGCCGCCATACTG
GCCGACCCGCGCGGCGAGGAGCAGTTCGCGATCCGGCCCGACGGCGTCACCGTCGCCCGT
CTCGTCCCGGCACCGGCCCGCGCGGCGGGTACCCGGTGGACGCCGCGCGGGACCGTCCTG
GTCACCGGCGGCACCGGCGGCATCGGCGCGCACCTGGCCCGCTGGCTCGCCGGTGCGGGC
GCCGAGCACCTGGTGCTGCTCAACAGGCGGGGAGCGGAGGCGGCCGGTGCCGCCGACCTG
CGTGACGAACTGGTCGCGCTCGGCACGGGAGTCACCATCACGGCCTGCGACGTCGCCGAC
CGCGACCGGTTGGCGGCCGTCCTCGACGCCGCACGGGCGCAGGGACGGGTGGTCACGGCG
GTGTTCCACGCCGCCGGGATCTCCCGGTCCACAGCGGTACAGGAGCTGACCGAGAGCGAG
TTCACCGAGATCACCGACGCGAAGGTGCGGGGTACGGCGAACCTGGCCGAACTCTGTCCC
GAGCTGGACGCCCTCGTGCTGTTCTCCTCGAACGCGGCGGTGTGGGGCAGCCCGGGGCTG
GCCTCCTACGCGGCGGGCAACGCCTTCCTCGACGCCTTCGCCCGTCGTGGTCGGCGCAGT
GGGCTGCCGGTCACCTCGATCGCCTGGGGTCTGTGGGCCGGGCAGAACATGGCCGGTACC
GAGGGCGGCGACTACCTGCGCAGCCAGGGCCTGCGCGCCATGGACCCGCAGCGGGCGATC
GAGGAGCTGCGGACCACCCTGGACGCCGGGGACCCGTGGGTGTCGGTGGTGGACCTGGAC
CGGGAGCGGTTCGTCGAACTGTTCACCGCCGCCCGCCGCCGGCCCCTCTTCGACGAACTC
GGTGGGGTCCGCGCCGGGGCCGAGGAGACCGGTCAGGAATCGGATCTCGCCCGGCGGCTG
GCGTCGATGCCGGAGGCCGAACGTCACGAGCATGTCGCCCGGCTGGTCCGAGCCGAGGTG
GCAGCGGTGCTGGGCCACGGCACGCCGACGGTGATCGAGCGTGACGTCGCCTTCCGTGAC
CTGGGATTCGACTCCATGACCGCCGTCGACCTGCGGAACCGGCTCGCGGCGGTGACCGGG
GTCCGGGTGGCCACGACCATCGTCTTCGACCACCCGACAGTGGACCGCCTCACCGCGCAC
TACCTGGAACGACTCGTCGGTGAGCCGGAGGCGACGACCCCGGCTGCGGCGGTCGTCCCG
CAGGCACCCGGGGAGGCCGACGAGCCGATCGCGATCGTCGGGATGGCCTGCCGCCTCGCC
GGTGGAGTGCGTACCCCCGACCAGTTGTGGGACTTCATCGTCGCCGACGGCGACGCGGTC
ACCGAGATGCCGTCGGACCGGTCCTGGGACCTCGACGCGCTGTTCGACCCGGACCCCGAG
CGGCACGGCACCAGCTACTCCCGGCACGGCGCGTTCCTGGACGGGGCGGCCGACTTCGAC
GCGGCGTTCTTCGGGATCTCGCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGCAG
GTCCTGGAGACGACGTGGGAGCTGTTCGAGAACGCCGGCATCGACCCGCACTCCCTGCGC
GGTACGGACACCGGTGTCTTCCTCGGCGCTGCGTACCAGGGGTACGGCCAGAACGCGCAG
GTGCCGAAGGAGAGTGAGGGTTACCTGCTCACCGGTGGTTCCTCGGCGGTCGCCTCCGGT
CGGATCGCGTACGTGTTGGGGTTGGAGGGGCCGGCGATCACTGTGGACACGGCGTGTTCG
TCGTCGCTTGTGGCGTTGCACGTGGCGGCCGGGTCGCTGCGATCGGGTGACTGTGGGCTC
GCGGTGGCGGGTGGGGTGTCGGTGATGGCCGGTCCGGAGGTGTTCACCGAGTTCTCCAGG
CAGGGCGCGCTGGCCCCCGACGGTCGGTGCAAGCCCTTCTCCGACCAGGCCGACGGGTTC
GGATTCGCCGAGGGCGTCGCTGTGGTGCTCCTGCAGCGGTTGTCGGTGGCGGTGCGGGAG
GGGCGTCGGGTGTTGGGTGTGGTGGTGGGTTCGGCGGTGAATCAGGATGGGGCGAGTAAT
GGGTTGGCGGCGCCGTCGGGGGTGGCGCAGCAGCGGGTGATTCGGCGGGCGTGGGGTCGT
GCGGGTGTGTCGGGTGGGGATGTGGGTGTGGTGGAGGCGCATGGGACGGGGACGCGGTTG
GGGGATCCGGTGGAGTTGGGGGCGTTGTTGGGGACGTATGGGGTGGGTCGGGGTGGGGTG
GGTCCGGTGGTGGTGGGTTCGGTGAAGGCGAATGTGGGTCATGTGCAGGCGGCGGCGGGT
GTGGTGGGTGTGATCAAGGTGGTGTTGGGGTTGGGTCGGGGGTTGGTGGGTCCGATGGTG
TGTCGGGGTGGGTTGTCGGGGTTGGTGGATTGGTCGTCGGGTGGGTTGGTGGTGGCGGAT
GGGGTGCGGGGGTGGCCGGTGGGTGTGGATGGGGTGCGTCGGGGTGGGGTGTCGGCGTTT
GGGGTGTCGGGGACGAATGCTCATGTGGTGGTGGCGGAGGCGCCGGGGTCGGTGGTGGGG
GCGGAACGGCCGGTGGAGGGGTCGTCGCGGGGGTTGGTGGGGGTGGCTGGTGGTGTGGTG
CCGGTGGTGCTGTCGGCAAAGACCGAAACCGCCCTGACCGAGCTCGCCCGACGACTGCAC
GACGCCGTCGACGACACCGTCGCCCTCCCGGCGGTGGCCGCCACCCTCGCCACCGGACGC
GCCCACCTGCCCTACCGGGCCGCCCTGCTGGCCCGCGACCACGACGAACTGCGCGACAGG
CTGCGGGCGTTCACCACTGGTTCGGCGGCTCCCGGTGTGGTGTCGGGGGTGGCGTCGGGT
GGTGGTGTGGTGTTTGTTTTTCCTGGTCAGGGTGGTCAGTGGGTGGGGATGGCGCGGGGG
TTGTTGTCGGTTCCGGTGTTTGTGGAGTCGGTGGTGGAGTGTGATGCGGTGGTGTCGTCG
GTGGTGGGGTTTTCGGTGTTGGGGGTGTTGGAGGGTCGGTCGGGTGCGCCGTCGTTGGAT
CGGGTGGATGTGGTGCAGCCGGTGTTGTTCGTGGTGATGGTGTCGTTGGCGCGGTTGTGG
CGGTGGTGTGGGGTTGTGCCTGCGGCGGTGGTGGGTCATTCGCAGGGGGAGATCGCGGCG
GCGGTGGTGGCGGGGGTGTTGTCGGTGGGTGATGGTGCGCGGGTGGTGGCGTTGCGGGCG
CGGGCGTTGCGGGCGTTGGCCGGCCACGGCGGCATGGTCTCCCTCGCGGTCTCCGCCGAA
CGCGCCCGGGAGCTGATCGCACCCTGGTCCGACCGGATCTCGGTGGCGGCGGTCAACTCC
CCGACCTCGGTGGTGGTCTCGGGTGACCCACAGGCCCTCGCCGCCCTCGTCGCCCACTGC
GCCGAGACCGGTGAGCGGGCCAAGACGCTGCCTGTGGACTACGCCTCCCACTCCGCCCAC
GTCGAACAGATCCGCGACACGATCCTCACCGACCTGGCCGACGTCACGGCGCGCCGACCC
GACGTCGCCCTCTACTCCACGCTGCACGGCGCCCGGGGCGCCGGCACGGACATGGACGCC
CGGTACTGGTACGACAACCTGCGCTCACCGGTGCGCTTCGACGAGGCCGTCGAGGCCGCC
GTCGCCGACGGCTACCGGGTCTTCGTCGAGATGAGCCCACACCCGGTCCTCACCGCCGCG
GTGCAGGAGATCGACGACGAGACGGTGGCCATCGGCTCGCTGCACCGGGACACCGGCGAG
CGGCACCTGGTCGCCGAACTCGCCCGGGCCCACGTGCACGGCGTACCAGTGGACTGGCGG
GCGATCCTCCCCGCCACCCACCCGGTTCCCCTGCCGAACTACCCGTTCGAGGCGACCCGG
TACTGGCTCGCCCCGACGGCGGCCGACCAGGTCGCCGACCACCGCTACCGCGTCGACTGG
CGGCCCCTGGCCACCACCCCGGCGGAGCTGTCCGGCAGCTACCTCGTCTTCGGCGACGCC
CCGGAGACCCTCGGCCACAGCGTCGAGAAGGCCGGCGGGCTCCTCGTCCCGGTGGCCGCT
CCCGACCGGGAGTCCCTCGCGGTCGCCCTGGACGAGGCGGCCGGACGACTCGCCGGTGTG
CTCTCCTTCGCCGCCGACACCGCCACCCACCTGGCCCGGCACCGACTCCTCGGCGAGGCC
GACGTCGAGGCCCCACTCTGGCTGGTCACCAGCGGCGGCGTCGCACTCGACGACCACGAC
CCGATCGACTGCGACCAGGCAATGGTGTGGGGGATCGGACGGGTGATGGGTCTGGAGACC
CCGCACCGGTGGGGCGGCCTGGTGGACGTGACCGTCGAACCCACCGCCGAGGACGGGGTG
GTCTTCGCCGCCCTCCTGGCCGCCGACGACCACGAGGACCAGGTGGCGCTGCGCGACGGC
ATCCGCCACGGCCGACGGCTCGTCCGCGCCCCGCTGACCACCCGAAACGCCAGGTGGACA
CCGGCGGGCACGGCGCTCGTCACGGGCGGTACGGGTGCCCTCGGCGGCCACGTCGCGCGG
TACCTGGCCCGGTCCGGGGTGACCGATCTCGTCCTGCTCAGCAGGAGCGGCCCCGACGCA
CCCGGTGCCGCCGAACTGGCCGCCGAACTGGCCGACCTCGGGGCCGAGCCGAGAGTCGAG
GCGTGCGACGTCACCGACGGGCCACGCCTGCGCGCCCTGGTGCAGGAGCTACGGGAACAG
GACCGGCCGGTCCGGATCGTCGTCCACACCGCAGGGGTGCCCGACTCCCGTCCCCTCGAC
CGGATCGACGAACTGGAGTCGGTCAGCGCCGCGAAGGTGACCGGGGCGCGGCTGCTCGAC
GAGCTCTGCCCGGACGCCGACACCTTCGTCCTGTTCTCCTCGGGGGCGGGAGTGTGGGGT
AGCGCGAACCTGGGCGCGTACGCGGCAGCCAACGCCTACCTGGACGCCCTGGCCCACCGC
CGCCGCCAGGCGGGCCGGGCCGCGACCTCGGTCGCCTGGGGGGCGTGGGCCGGCGACGGC
ATGGCCACCGGCGACCTCGACGGGCTGACCCGGCGCGGTCTGCGGGCGATGGCACCGGAC
CGGGCGCTGCGCGCCTGCACCAGGCGTTGGACCACCCACGACACCTGTGTGTCGGTAGCC
GACGTCGACTGGGACCGCTTCGCCGTGGGTTTCACCGCCGCCCGGCCCAGACCCCTGATC
GACGAACTCGTCACCTCCGCGCCGGTGGCCGCCCCCACCGCTGCGGCGGCCCCGGTCCCG
GCGATGACCGCCGACCAGCTACTCCAGTTCACGCGCTCGCACGTGGCCGCGATCCTCGGT
CACCAGGACCCGGACGCGGTCGGGTTGGACCAGCCCTTCACCGAGCTGGGCTTCGACTCG
CTCACCGCCGTCGGCCTGCGCAACCAGCTCCAGCAGGCCACCGGGCGGACGCTGCCCGCC
GCCCTGGTGTTCCAGCACCCCACGGTACGCAGACTCGCCGACCACCTCGCGCAGCAGCTC
GACGTCGGCACCGCCCCGGTCGAGGCGACGGGCAGCGTCCTGCGGGACGGCTACCGGCGG
GCCGGGCAGACCGGCGACGTCCGGTCGTACCTGGACCTGCTGGCGAACCTGTCGGAGTTC
CGGGAGCGGTTCACCGACGCGGCGAGCCTGGGCGGACAGCTGGAACTCGTCGACCTGGCC
GACGGATCCGGCCCGGTCACTGTGATCTGTTGCGCGGGCACTGCGGCGCTCTCCGGGCCG
CACGAGTTCGCCCGACTCGCCTCGGCGCTGCGCGGCACCGTGCCGGTGCGCGCCCTCGCG
CAACCCGGGTACGAGGCGGGTGAACCGGTGCCGGCGTCGATGGAGGCAGTGCTCGGGGTG
CAGGCGGACGCGGTCCTCGCGGCACAGGGCGACACGCCGTTCGTGCTGGTCGGACACTCG
GCGGGGGCCCTGATGGCGTACGCCCTGGCGACCGAGCTGGCCGACCGGGGCCACCCGCCA
CGTGGCGTCGTGCTCCTCGACGTGTACCCACCCGGTCACCAGGAGGCGGTGCACGCCTGG
CTCGGCGAGCTGACCGCCGCCCTGTTCGACCACGAGACCGTACGGATGGACGACACCCGG
CTCACGGCCCTGGGGGCGTACGACAGGCTGACCGGCAGGTGGCGTCCGAGGGACACCGGT
CTGCCCACGCTGGTGGTGGCCGCCAGCGAGCCGATGGGGGAGTGGCCGGACGACGGTTGG
CAGTCCACGTGGCCGTTCGGGCACGACAGGGTCACGGTGCCCGGTGACCACTTCTCGATG
GTGCAGGAGCACGCCGACGCGATCGCGCGGCACATCGACGCCTGGTTGAGCGGGGAGAGG
GCATGA
[5] KS39..403
[5] AT574..893
[5] methylmalonyl-CoA762..766
[5] KR1137..1315
[5] ACP1412..1482
[6] KS1507..1878
[6] AT2044..2356
[6] methylmalonyl-CoA2234..2238
[6] KR2583..2759
[6] ACP2847..2917
[6] TE2989..3196
[5] KS115..1209
[5] AT1720..2679
[5] methylmalonyl-CoA2284..2298
[5] KR3409..3945
[5] ACP4234..4446
[6] KS4519..5634
[6] AT6130..7068
[6] methylmalonyl-CoA6700..6714
[6] KR7747..8277
[6] ACP8539..8751
[6] TE8965..9588

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [2989-3196]  6.40000000000004e-42 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [566-694]  G3DSA:3.40.366.10 [762-882]  G3DSA:3.40.366.10 [2043-2163]  G3DSA:3.40.366.10 [2232-2338]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2583-2745]  6.09999999999996e-54 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1440-1455]  PS00012 [2875-2890]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1412-1482]  PS50075 [2847-2917]  PS50075
PS50075   ACP_DOMAIN
 [1405-1524]  2.10000267834031e-26 SSF47336
SSF47336   ACP_like
 [1410-1485]  5.30000000000001e-42 G3DSA:1.10.1200.10 [2845-2920]  5.30000000000001e-42 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1415-1480]  7.09999999999999e-11 PF00550 [2853-2916]  4.3e-15 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1137-1314]  1.40000000000001e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [39-276]  1.9e-84 PF00109 [1507-1756]  5.69999999999998e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [285-403]  2.8e-48 PF02801 [1765-1878]  1.09999999999999e-34 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [574-893]  1e-108 PF00698 [2044-2356]  8.90000000000015e-98 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-39]  8.80000265836278e-18 SSF101173
SSF101173   Polyketide_synth_docking
 [8-32]  8.40000000000001e-05 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [572-856]  1.50000965748778e-67 SSF52151 [2042-2328]  1.70000295590053e-61 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [696-761]  1.20000117458134e-16 SSF55048 [2168-2233]  9.19998414420358e-19 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [38-287]  G3DSA:3.40.47.10 [289-455]  3.49999999999995e-116 G3DSA:3.40.47.10 [1510-1770]  G3DSA:3.40.47.10 [1771-1935]  3.49999999999995e-116 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [31-401]  9.90001804798383e-98 SSF53901 [1500-1884]  1.90000694315261e-90 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1137-1323]  1.39999999999997e-66 G3DSA:3.40.50.720 [2583-2787]  1.20000000000001e-66 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [190-206]  PS00606 [1670-1686]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [576-873]  1.19999063421924e-120 SM00827 [2046-2338]  2.0000139277205e-108 SM00827
SM00827   PKS_AT
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [2989-3196]  1.39999277195148e-120 SM00824
SM00824   PKS_TE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1413-1485]  1.29999924468179e-28 SM00823 [2848-2920]  2.1000026783403e-33 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [41-455]  SM00825 [1510-1936]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1137-1315]  6.4999795054176e-47 SM00822 [2583-2759]  1.60000240695997e-43 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit