close all open/close all

CDS information : Megalo_00150


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction43,268 / 44,344 / + [in whole cluster]
43,268 / 44,344 / + [in contig]
Location43268..44344 [in whole cluster]
43268..44344 [in contig]
TypeCDS
Length1,077 bp (358 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase helper protein
Product (GenBank)TDP-4-keto-6-deoxyglucose 3,4-isomerase
Gene
Gene (GenBank)megCII
EC number
Keyword
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>glycosyltransferase helper protein [TDP-4-keto-6-deoxyglucose 3,4-isomerase]
MNTTDRAVLGRRLQMIRGLYWGYGSNGDPYPMLLCGHDDDPHRWYRGLGGSGVRRSRTET
WVVTDHATAVRVLDDPTFTRATGRTPEWMRAAGAPASTWAQPFRDVHAASWDAELPDPQE
VEDRLTGLLPAPGTRLDLVRDLAWPMASRGVGADDPDVLRAAWDARVGLDAQLTPQPLAV
TEAAIAAVPGDPHRRALFTAVEMTATAFVDAVLAVTATAGAAQRLADDPDVAARLVAEVL
RLHPTAHLERRTAGTETVVGEHTVAAGDEVVVVVAAANRDAGVFADPDRLDPDRADADRA
LSAQRGHPGRLEELVVVLTTAALRSVAKALPGLTAGGPVVRRRRSPVLRATAHCPVEL
selected fasta
>glycosyltransferase helper protein [TDP-4-keto-6-deoxyglucose 3,4-isomerase]
ATGAACACGACCGATCGCGCCGTGCTGGGCCGACGACTCCAGATGATCCGGGGACTGTAC
TGGGGTTACGGCAGCAACGGAGACCCGTACCCGATGCTGTTGTGCGGGCACGACGACGAC
CCGCACCGCTGGTACCGGGGGCTGGGCGGATCCGGGGTCCGGCGCAGCCGTACCGAGACG
TGGGTGGTGACCGACCACGCCACCGCCGTGCGGGTGCTCGACGACCCGACCTTCACCCGG
GCCACCGGCCGGACGCCGGAGTGGATGCGGGCCGCGGGCGCCCCGGCCTCGACCTGGGCG
CAGCCGTTCCGTGACGTGCACGCCGCGTCCTGGGACGCCGAACTGCCCGACCCGCAGGAG
GTGGAGGACCGGCTGACGGGTCTCCTGCCTGCCCCGGGGACCCGCCTGGACCTGGTCCGC
GACCTCGCCTGGCCGATGGCGTCGCGGGGGGTCGGCGCGGACGACCCCGACGTGCTGCGC
GCCGCGTGGGACGCCCGGGTCGGCCTCGACGCCCAGCTCACCCCGCAGCCCCTGGCGGTG
ACCGAGGCGGCGATCGCCGCGGTGCCCGGGGACCCGCACCGGCGGGCGCTGTTCACCGCC
GTCGAGATGACAGCCACCGCGTTCGTCGACGCGGTGCTGGCGGTGACCGCCACGGCGGGG
GCGGCCCAGCGTCTCGCCGACGACCCCGACGTCGCCGCCCGTCTCGTCGCGGAGGTGCTG
CGCCTGCATCCGACGGCGCACCTGGAACGGCGTACCGCCGGCACCGAGACGGTGGTGGGC
GAGCACACGGTCGCGGCGGGCGACGAGGTCGTCGTGGTGGTCGCCGCCGCCAACCGTGAC
GCGGGGGTCTTCGCCGACCCGGACCGCCTCGACCCGGACCGGGCCGACGCCGACCGGGCC
CTGTCCGCCCAGCGCGGTCACCCCGGCCGGTTGGAGGAGCTGGTGGTGGTCCTGACCACC
GCCGCACTGCGCAGCGTCGCCAAGGCGCTGCCCGGTCTCACCGCCGGTGGCCCGGTCGTC
AGGCGACGTCGTTCACCGGTCCTGCGAGCCACCGCCCACTGCCCGGTCGAACTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [197-298]  5.80000000000004e-21 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [235-298]  4.70000000000001e-09 PF00067
PF00067   p450
 [28-358]  4.90001027782405e-21 SSF48264
SSF48264   Cytochrome_P450
SignalP
 [1-27]  0.235 Signal
Eukaryota   
TMHMM No significant hit