close all open/close all

CDS information : Megalo_00160


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction44,355 / 45,623 / + [in whole cluster]
44,355 / 45,623 / + [in contig]
Location44355..45623 [in whole cluster]
44355..45623 [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-D-desosamine glycosyltransferase
Product (GenBank)TDP-desosamine glycosyltransferase
Gene
Gene (GenBank)megCIII
EC number
Keyword
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>dTDP-D-desosamine glycosyltransferase [TDP-desosamine glycosyltransferase]
MRVVFSSMASKSHLFGLVPLAWAFRAAGHEVRVVASPALTDDITAAGLTAVPVGTDVDLV
DFMTHAGYDIIDYVRSLDFSERDPATSTWDHLLGMQTVLTPTFYALMSPDSLVEGMISFC
RSWRPDWSSGPQTFAASIAATVTGVAHARLLWGPDITVRARQKFLGLLPGQPAAHREDPL
AEWLTWSVERFGGRVPQDVEELVVGQWTIDPAPVGMRLDTGLRTVGMRYVDYNGPSVVPD
WLHDEPTRRRVCLTLGISSRENSIGQVSVDDLLGALGDVDAEIIATVDEQQLEGVAHVPA
NIRTVGFVPMHALLPTCAATVHHGGPGSWHTAAIHGVPQVILPDGWDTGVRAQRTEDQGA
GIALPVPELTSDQLREAVRRVLDDPAFTAGAARMRADMLAEPSPAEVVDVCAGLVGERTA
VG
selected fasta
>dTDP-D-desosamine glycosyltransferase [TDP-desosamine glycosyltransferase]
ATGCGCGTCGTCTTCTCCTCCATGGCCAGCAAGAGCCACCTGTTCGGTCTCGTTCCCCTC
GCCTGGGCCTTCCGCGCGGCGGGCCACGAGGTACGGGTCGTCGCCTCACCGGCTCTCACC
GACGACATCACGGCGGCCGGACTGACGGCCGTACCGGTCGGCACCGACGTCGACCTTGTC
GACTTCATGACCCACGCCGGGTACGACATCATCGACTACGTCCGCAGCCTGGACTTCAGC
GAGCGGGACCCGGCCACCTCCACCTGGGACCACCTGCTCGGCATGCAGACCGTCCTCACC
CCGACCTTCTACGCCCTGATGAGCCCGGACTCGCTGGTCGAGGGCATGATCTCCTTCTGT
CGGTCGTGGCGACCCGACTGGTCGTCTGGACCGCAGACCTTCGCCGCGTCGATCGCGGCG
ACGGTGACCGGCGTGGCCCACGCCCGACTCCTGTGGGGACCCGACATCACGGTACGGGCC
CGGCAGAAGTTCCTCGGGCTGCTGCCCGGACAGCCCGCCGCCCACCGGGAGGACCCCCTC
GCCGAGTGGCTCACCTGGTCTGTGGAGAGGTTCGGCGGCCGGGTGCCGCAGGACGTCGAG
GAGCTGGTGGTCGGGCAGTGGACGATCGACCCCGCCCCGGTCGGGATGCGCCTCGACACC
GGGCTGAGGACGGTGGGCATGCGCTACGTCGACTACAACGGCCCGTCGGTGGTGCCGGAC
TGGCTGCACGACGAGCCGACCCGCCGACGGGTCTGCCTCACCCTGGGCATCTCCAGCCGG
GAGAACAGCATCGGGCAGGTCTCCGTCGACGACCTGTTGGGTGCGCTCGGTGACGTCGAC
GCCGAGATCATCGCGACAGTGGACGAGCAGCAGCTCGAAGGCGTCGCCCACGTCCCGGCC
AACATCCGTACGGTCGGGTTCGTCCCGATGCACGCACTGCTGCCGACCTGCGCGGCGACG
GTGCACCACGGCGGTCCCGGCAGCTGGCACACCGCCGCCATCCACGGCGTGCCGCAGGTG
ATCCTGCCCGACGGCTGGGACACCGGGGTCCGCGCCCAGCGGACCGAGGACCAGGGGGCG
GGCATCGCCCTGCCGGTGCCCGAGCTGACCTCCGACCAGCTCCGCGAGGCGGTGCGGCGG
GTCCTGGACGATCCCGCCTTCACCGCCGGTGCGGCGCGGATGCGGGCCGACATGCTCGCC
GAGCCGTCCCCCGCCGAGGTCGTCGACGTCTGTGCGGGGCTGGTCGGGGAACGGACCGCC
GTCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-86]  1.9e-13 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [209-303]  3.2e-32 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.615 Signal
Bacteria, Gram-positive   
 [1-28]  0.989 Signal
Eukaryota   
 [1-28]  0.657 Signal
Bacteria, Gram-negative   
TMHMM No significant hit