close all open/close all

CDS information : Megalo_00170


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction45,620 / 46,591 / + [in whole cluster]
45,620 / 46,591 / + [in contig]
Location45620..46591 [in whole cluster]
45620..46591 [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-hexose C-3 ketoreductase component
Product (GenBank)TDP-4-keto-6-deoxyglucose 2,3 dehydratase
GenemegBIIa
Gene (GenBank)megBII
EC number
Keyword
  • mycarose
  • axial-OH
Note
Note (GenBank)
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
[17571859] Characterization of the heterodimeric MegBIIa:MegBIIb aldo-keto reductase involved in the biosynthesis of L-mycarose from Micromonospora megalomicea. (Biochemistry. , 2007)

close this sectionSequence

selected fasta
>dTDP-hexose C-3 ketoreductase component [TDP-4-keto-6-deoxyglucose 2,3 dehydratase]
MSTDATHVRLGRCALLTSRLWLGTAALAGQDDADAVRLLDHARSRGVNCLDTADDDSAST
SAQVAEESVGRWLAGDTGRREETVLSVTVGVPPGGQVGGGGLSARQIIASCEGSLRRLGV
DHVDVLHLPRVDRVEPWDEVWQAVDALVAAGKVCYVGSSGFPGWHIVAAQEHAVRRHRLG
LVSHQCRYDLTSRHPELEVLPAAQAYGLGVFARPTRLGGLLGGDGPGAAAARASGQPTAL
RSAVEAYEVFCRDLGEHPAEVALAWVLSRPGVAGAVVGARTPGRLDSALRACGVALGATE
LTALDGIFPGVAAAGAAPEAWLR
selected fasta
>dTDP-hexose C-3 ketoreductase component [TDP-4-keto-6-deoxyglucose 2,3 dehydratase]
ATGAGCACCGACGCCACCCACGTCCGGCTCGGCCGGTGCGCCCTGCTGACCAGCCGGCTC
TGGCTGGGTACGGCAGCCCTCGCCGGCCAGGACGACGCCGACGCAGTACGCCTGCTCGAC
CACGCCCGTTCCCGGGGCGTCAACTGCCTCGACACCGCCGACGACGACTCTGCGTCGACC
AGTGCCCAGGTCGCCGAGGAGTCGGTCGGCCGGTGGTTGGCCGGGGACACCGGTCGGCGG
GAGGAGACCGTCCTGTCGGTGACGGTGGGTGTCCCACCGGGCGGGCAGGTCGGCGGGGGC
GGCCTCTCCGCCCGGCAGATCATCGCCTCCTGTGAGGGCTCCCTGCGGCGTCTCGGTGTC
GACCACGTCGACGTCCTTCACCTGCCCCGGGTGGACCGGGTGGAGCCGTGGGACGAGGTC
TGGCAGGCGGTGGACGCCCTCGTGGCCGCCGGAAAGGTCTGTTACGTCGGGTCGTCGGGC
TTCCCCGGATGGCACATCGTCGCCGCCCAGGAGCACGCCGTCCGCCGTCACCGCCTCGGC
CTGGTGTCCCACCAGTGTCGGTACGACCTGACGTCGCGCCATCCCGAACTGGAGGTCCTG
CCCGCCGCGCAGGCGTACGGGCTCGGGGTCTTCGCCAGGCCGACCCGCCTCGGCGGTCTG
CTCGGCGGCGACGGTCCGGGCGCCGCAGCCGCACGGGCGTCGGGACAGCCGACGGCACTG
CGCTCGGCGGTGGAGGCGTACGAGGTGTTCTGCAGAGACCTCGGCGAGCACCCCGCCGAG
GTCGCACTGGCGTGGGTGCTGTCCCGGCCCGGTGTGGCGGGGGCGGTCGTCGGTGCGCGG
ACGCCCGGACGGCTCGACTCCGCGCTCCGCGCCTGCGGCGTCGCCCTCGGCGCGACGGAA
CTCACCGCCCTGGACGGGATCTTCCCCGGGGTCGCCGCAGCAGGGGCGGCCCCGGAGGCG
TGGCTACGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [5-316]  7.60000011115808e-62 SSF51430
SSF51430   Aldo/ket_red
 [7-308]  1.6e-57 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
 [20-308]  3.5e-45 PF00248
PF00248   Aldo_ket_red
SignalP
 [1-28]  0.713 Signal
Bacteria, Gram-negative   
 [1-28]  0.944 Signal
Eukaryota   
 [1-28]  0.539 Signal
Bacteria, Gram-positive   
TMHMM No significant hit