close all open/close all

CDS information : Megalo_00180


close this sectionLocation

Organism
StrainNRRL 3275 (=NBRC 14744)
Entry nameMegalomicin
Contig
Start / Stop / Direction47,403 / 46,660 / - [in whole cluster]
47,403 / 46,660 / - [in contig]
Locationcomplement(46660..47403) [in whole cluster]
complement(46660..47403) [in contig]
TypeCDS
Length744 bp (247 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)TEII
Gene
Gene (GenBank)megH
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • putative thioesterase
Reference
ACC
PmId
[10972798] Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea. (Mol Microbiol. , 2000)
Related Reference
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative type II thioesterase [TEII]
MNTWLRRFGSADGHRARLYCFPHAGAAADSYLDLARALAPEVDVWAVQYPGRQDRRDERA
LGTAGEIADEVAAVLRDLVGEVPFALFGHSMGALVAYETARRLEARPGVRPLRLFVSGQT
APRVHERRTDLPDEDGLVEQMRRLGVSEAALADQGLLDMSLPVLRADHRVLRSYAWQAGP
PLRAGITTLCGDTDPLTTVEDAQRWLPYSVVPGRTRTFPGGHFYLADHVGEVAESVAPDL
LRLTPTG
selected fasta
>putative type II thioesterase [TEII]
ATGAACACCTGGTTGCGGCGGTTCGGGTCCGCCGACGGACACCGGGCCCGGCTGTACTGC
TTCCCGCACGCGGGAGCCGCCGCCGACTCGTACCTCGACCTCGCCCGGGCACTGGCCCCG
GAGGTCGACGTGTGGGCGGTGCAGTACCCGGGCCGGCAGGACCGACGTGACGAGCGGGCT
CTCGGCACCGCCGGGGAGATCGCCGACGAGGTCGCGGCCGTGCTGCGCGACCTCGTCGGC
GAGGTTCCGTTCGCCCTGTTCGGTCACAGCATGGGCGCCCTGGTCGCCTACGAGACCGCC
CGTCGCCTGGAGGCTCGTCCGGGGGTGCGACCGCTGCGGTTGTTCGTCTCCGGGCAGACC
GCCCCCCGGGTCCACGAGCGGCGCACCGACCTGCCCGACGAGGACGGACTCGTCGAGCAG
ATGCGCAGGCTCGGGGTCAGCGAGGCCGCATTGGCCGACCAGGGGCTGTTGGACATGTCG
CTGCCGGTGCTGCGGGCCGACCACCGGGTGCTGCGCTCCTACGCCTGGCAGGCCGGGCCG
CCGCTGCGGGCCGGCATCACCACCCTCTGCGGTGACACCGACCCGTTGACGACGGTGGAG
GACGCCCAACGCTGGCTGCCGTACTCGGTAGTCCCCGGCCGTACCCGGACCTTCCCGGGC
GGGCACTTCTACCTCGCCGACCACGTCGGGGAGGTGGCCGAGTCGGTGGCGCCGGACCTG
CTGCGGCTCACCCCCACCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [17-238]  1.6e-54 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit