close all open/close all
first first   Meili_00020 Meili_00020

CDS information : Meili_00010


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction1,337 / 3 / - [in whole cluster]
1,337 / 3 / - [in contig]
Locationcomplement(3..1337) [in whole cluster]
complement(3..1337) [in contig]
TypeCDS
Length1,335 bp (444 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative Na(+)/H(+) antiporter(fragment)
putative sodium/proton antiporter(fragment)
Product (GenBank)Na+/H+ antiporter
GenenhaA
Gene (GenBank)
EC number
Keyword
Note
  • Sequence status of this ORF is fragment.
Note (GenBank)
  • orf1
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)
Family/Domain
FD
IPR004670

close this sectionSequence

selected fasta
>putative Na(+)/H(+) antiporter(fragment) [Na+/H+ antiporter]
MSSEANDYTEQTACAADSHSPLRDFLRTETGSAAVLVTAAFAALIWANLTPSAYEAFWHT
HLSLRLGSHGIALNLREWVNSGLMTVFFFVVGLEARREFDMGELRERSRLALPVAAGLCG
MLVPVALYLTINAGHASAQGWGAAMSTDTAFALGILAVVGRHMPSSLRVFILTITVVDDF
LALAVIAIAYSSDLSVPALLVAVGTFAVVLLVRRLGVRRGAVYAVLAVVAWVAMLESGVD
PVVIGLAMGLLTYAYPAARSDLERATGLFRLFREQPTPELERSVRAGLASAISPNDRLQQ
IFHPWAGYVIVPLFALANAGIPISGEQLSRAFSSPVTLGILLGYTLGKPIGVIGASALTT
WLSRGRIRLPVGWGALAVGGSLSGVGFTVSLLIATLAFHGTGLQDAKIGILSAVLCSFLI
SWLITRAIGGLPREAQLRALLGKAE
selected fasta
>putative Na(+)/H(+) antiporter(fragment) [Na+/H+ antiporter]
ATGTCCTCCGAGGCCAACGACTACACGGAGCAGACCGCCTGCGCAGCCGACTCGCACTCC
CCGCTCCGTGACTTCCTGCGGACCGAAACCGGCAGCGCCGCCGTCCTGGTGACGGCGGCG
TTCGCCGCGCTCATCTGGGCCAATCTGACGCCCTCGGCCTATGAGGCGTTCTGGCATACC
CATCTGTCCCTGCGGCTCGGCTCCCACGGCATCGCGCTCAACCTGCGTGAATGGGTCAAC
AGCGGGCTGATGACGGTGTTCTTCTTCGTCGTCGGCCTGGAGGCACGGCGCGAGTTCGAC
ATGGGGGAACTGCGCGAACGCAGCCGACTGGCCCTGCCCGTCGCGGCGGGCCTGTGCGGC
ATGCTCGTACCGGTTGCCCTCTACCTCACGATCAACGCCGGCCACGCATCCGCGCAGGGC
TGGGGTGCGGCCATGTCCACCGACACCGCCTTCGCCCTGGGGATCCTCGCCGTGGTCGGC
CGGCACATGCCCTCCAGTCTGCGGGTTTTCATCCTCACCATCACCGTGGTCGACGACTTC
CTGGCGCTGGCCGTCATCGCCATCGCGTACAGCAGCGACCTCTCCGTCCCGGCGCTGCTG
GTGGCCGTGGGCACCTTCGCCGTCGTCCTGCTGGTGCGGCGGCTGGGAGTGCGCCGCGGC
GCCGTCTACGCGGTGCTCGCGGTGGTGGCGTGGGTCGCCATGCTCGAATCGGGTGTGGAC
CCCGTGGTCATCGGGCTGGCCATGGGGCTGCTGACCTACGCCTACCCCGCGGCGCGCAGC
GATCTGGAGCGTGCCACCGGGCTGTTCCGACTGTTCCGGGAACAGCCCACCCCCGAGCTC
GAGCGCTCCGTCCGCGCCGGACTGGCCTCCGCGATCTCGCCCAACGACCGCCTGCAGCAG
ATCTTCCACCCCTGGGCCGGCTATGTCATCGTGCCCCTCTTCGCCCTGGCCAACGCCGGC
ATCCCGATCAGCGGCGAGCAGCTGTCACGCGCGTTCTCCTCACCGGTCACCCTCGGCATC
CTGCTCGGATACACCCTCGGCAAGCCGATCGGCGTCATCGGCGCGTCGGCACTCACCACC
TGGCTCAGCCGCGGCCGCATCCGGCTGCCGGTCGGGTGGGGGGCCCTCGCCGTCGGGGGC
TCGCTGTCCGGAGTGGGCTTCACGGTCTCCCTGCTGATCGCCACCCTCGCCTTCCACGGC
ACCGGCCTCCAGGACGCCAAGATCGGCATCCTGAGCGCCGTCCTCTGCTCCTTCCTCATC
AGCTGGCTGATCACCCGCGCCATCGGAGGGCTTCCGCGAGAAGCACAGCTGCGAGCGCTG
CTGGGCAAGGCCGAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004670 Na+/H+ antiporter NhaA (Family)
 [23-423]  4.3e-118 PF06965
PF06965   Na_H_antiport_1
 [25-420]  4.6e-82 TIGR00773
TIGR00773   NhaA: Na+/H+ antiporter NhaA
 [22-434]  18.656 MF_01844
MF_01844   NhaA
IPR023171 Na/H antiporter domain (Domain)
 [288-427]  9e-117 G3DSA:1.20.1530.10
G3DSA:1.20.1530.10   no description
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [32-54]  Transmembrane (i-o) [69-91]  Transmembrane (o-i) [111-133]  Transmembrane (i-o) [138-160]  Transmembrane (o-i) [167-189]  Transmembrane (i-o) [194-212]  Transmembrane (o-i) [301-323]  Transmembrane (i-o) [336-358]  Transmembrane (o-i) [371-393]  Transmembrane (i-o) [408-430]  Transmembrane (o-i)
Transmembrane 10   
first first   Meili_00020 Meili_00020