close all open/close all

CDS information : Meili_00020


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction2,280 / 1,603 / - [in whole cluster]
2,280 / 1,603 / - [in contig]
Locationcomplement(1603..2280) [in whole cluster]
complement(1603..2280) [in contig]
TypeCDS
Length678 bp (225 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productpeptidase C56 family protein
Product (GenBank)intracellular protease/amidase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf2
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>peptidase C56 family protein [intracellular protease/amidase]
MPGTRKILLALTSHQELGETGRTTGFYVGEAAHPWKVLSDAGYEVDLVSVSGGRPPMDGR
DLSDPIQQAFLEDPRIAEQLAATARPEDITPGDYDAIVYVGGHGTVWDFPDSAGLAGIAR
DIYEAGGAVAAVCHGPAGLVNLKLSNGAYLVDGKNVAAFTNSEEAAVGLTDVVPFLLQSK
LEERGAKHTGAPDFEPHVVVDGRLVTGQNPASATALGEALVKVLI
selected fasta
>peptidase C56 family protein [intracellular protease/amidase]
ATGCCCGGCACCCGAAAGATCCTGCTCGCCCTGACCAGCCACCAGGAACTTGGCGAAACC
GGCCGGACCACAGGCTTCTATGTGGGCGAGGCCGCGCACCCCTGGAAGGTCCTGTCCGAC
GCCGGTTACGAGGTCGACCTGGTCTCGGTCTCCGGGGGCCGTCCGCCGATGGACGGCCGC
GACCTGTCCGATCCGATCCAGCAGGCATTCCTGGAGGATCCGCGTATCGCGGAGCAGCTG
GCGGCGACGGCCCGGCCGGAGGACATCACCCCCGGCGACTACGACGCCATCGTGTACGTG
GGCGGCCACGGCACCGTATGGGACTTCCCCGACAGCGCCGGCCTCGCCGGTATCGCGCGC
GACATCTACGAGGCCGGAGGGGCGGTCGCCGCGGTGTGCCACGGCCCGGCGGGCCTGGTC
AACCTCAAGCTGTCCAACGGGGCGTATCTGGTCGACGGCAAGAACGTCGCGGCGTTCACC
AACAGCGAGGAGGCCGCGGTGGGGCTCACCGACGTGGTGCCGTTCCTGCTGCAGAGCAAG
CTCGAGGAGCGCGGCGCCAAGCACACCGGCGCCCCCGACTTCGAACCGCATGTGGTCGTC
GACGGCCGCCTGGTCACCGGGCAGAACCCGGCCTCGGCCACCGCACTCGGGGAAGCCCTC
GTCAAGGTTCTCATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002818 ThiJ/PfpI (Domain)
 [77-224]  1.3e-24 PF01965
PF01965   DJ-1_PfpI
SignalP
 [1-18]  0.4 Signal
Bacteria, Gram-negative   
TMHMM No significant hit