close all open/close all

CDS information : Meili_00030


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction2,432 / 3,331 / + [in whole cluster]
2,432 / 3,331 / + [in contig]
Location2432..3331 [in whole cluster]
2432..3331 [in contig]
TypeCDS
Length900 bp (299 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LysR family transcriptional regulator
Product (GenBank)LysR-family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf3
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)
Family/Domain
FD
IPR000847
FD
IPR005119

close this sectionSequence

selected fasta
>putative LysR family transcriptional regulator [LysR-family transcriptional regulator]
MDLSLLKTFLAVHRSGSLTAAARQVGRSQSTVTAQIRTLEEQMGQQLFLRMPRGVVPTSV
ADELAAEAGPHVDALATIAERGVAGRTTPFTKPMHLAGPAELMSTRVLAALAPLIHDGLR
LRVTLGLTDELLAGLPDGRFDLVISTHRPRGKAIASVPLTDEEFVLVAAPRLAALVDGGQ
LRREGPVALRELPLISYAEDRPIIRRYWRTVFGTRPTSSPAVVVPDLRGVLTATVAGAGI
TVLPRYLCAKELASGALVPLLEPEIPPINTLYLAYRVGTENAPSIAAIRARLLMQAPSW
selected fasta
>putative LysR family transcriptional regulator [LysR-family transcriptional regulator]
GTGGATCTGTCCCTGCTGAAGACCTTCCTGGCCGTCCACCGGTCGGGTTCCCTCACGGCG
GCGGCGCGCCAGGTCGGCCGGTCCCAGTCCACCGTCACCGCGCAGATCCGCACGCTGGAG
GAGCAGATGGGGCAGCAGCTGTTTCTGCGTATGCCGCGGGGGGTCGTGCCGACGTCGGTG
GCCGATGAGCTCGCCGCCGAGGCCGGTCCGCATGTGGACGCCCTCGCCACCATCGCCGAG
CGTGGCGTCGCCGGCCGGACCACCCCGTTCACCAAGCCCATGCATCTGGCCGGCCCCGCC
GAACTCATGAGCACACGGGTGCTGGCCGCGCTGGCGCCACTGATCCATGACGGACTGCGG
CTGAGGGTGACCCTGGGGCTGACCGACGAGCTGCTGGCCGGTCTGCCCGACGGCCGGTTC
GACCTGGTCATCTCGACCCACCGCCCGCGCGGCAAGGCGATCGCTTCGGTGCCGCTCACG
GATGAGGAGTTCGTCCTGGTCGCCGCCCCGCGCCTGGCCGCGCTCGTGGACGGTGGGCAG
CTCAGGCGCGAAGGGCCGGTGGCCCTGCGTGAGCTGCCTCTGATCAGCTATGCGGAGGAC
CGCCCCATCATCCGCCGCTACTGGCGCACCGTGTTCGGCACCCGCCCCACGAGCAGCCCC
GCTGTCGTCGTCCCCGATCTGCGGGGTGTGCTGACCGCGACCGTCGCCGGGGCGGGGATC
ACGGTGCTGCCGCGCTATCTGTGCGCGAAGGAACTCGCTTCGGGTGCCCTGGTGCCGCTT
CTGGAACCCGAGATCCCGCCCATCAACACGCTCTACCTCGCCTATCGCGTCGGCACCGAG
AACGCGCCGTCGATCGCCGCCATTCGCGCACGGCTGCTCATGCAGGCGCCCTCGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000847 Transcription regulator HTH, LysR (Domain)
 [18-29]  4.99999811956429e-07 PR00039 [29-39]  4.99999811956429e-07 PR00039 [39-50]  4.99999811956429e-07 PR00039
PR00039   HTHLYSR
 [1-58]  PS50931
PS50931   HTH_LYSR
 [4-59]  8.00000000000001e-19 PF00126
PF00126   HTH_1
IPR005119 LysR, substrate-binding (Domain)
 [116-293]  4.00000000000001e-26 PF03466
PF03466   LysR_substrate
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [1-79]  5.00000000000001e-19 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-20]  0.387 Signal
Bacteria, Gram-negative   
 [1-22]  0.412 Signal
Bacteria, Gram-positive   
TMHMM No significant hit