close all open/close all

CDS information : Meili_00040


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction3,487 / 4,683 / + [in whole cluster]
3,487 / 4,683 / + [in contig]
Location3487..4683 [in whole cluster]
3487..4683 [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf4
Reference
ACC
PmId
[20348291] Cloning of separate meilingmycin biosynthesis gene clusters by use of acyltransferase-ketoreductase didomain PCR amplification. (Appl Environ Microbiol. , 2010)
Related Reference
ACC
P33271
PmId
[1732208] Characterization of Saccharopolyspora erythraea cytochrome P-450 genes and enzymes, including 6-deoxyerythronolide B hydroxylase. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P450]
MSIIFDPRDPSVRTDPYPIYRRLRETDPIHQSHFGYWILSRYADVDAVLRAPGASSEFYR
DRTWANRRGGPDSPLVQSVRKWMLMLDGPAHRRIRGAISKVFTRAAVERLRPRIAAETAR
LLDAVGDGKTDLIHSLALPLPVTVTCELLGLPGSDRDQCRRWTEQISRVIDPSITAEDAV
EMNAAEVEFREYVADHLKERRSAPRDDILSLLLHAEVDGGRLTEAEIIANVQFLFVAGHE
TTVNLIGNGLLALLRHPDQLRMLRDNPEIIADSIDEITRYDPPVQIVSRLLTEDVPLADV
TLPAGAKVMLLFGAASRDPERYPDPDRLDLTRTGVKTLAFSGGPHYCIGAALGKLETSMV
LTELLQRYSTIELADDDLVWRPNVSFRGLQELPLQLVC
selected fasta
>putative cytochrome P450 [cytochrome P450]
ATGAGCATAATTTTCGATCCGCGAGATCCGTCGGTCCGTACCGACCCCTATCCCATCTAT
CGGCGCCTGCGCGAAACAGACCCCATCCATCAATCACACTTCGGCTATTGGATTCTTTCG
CGCTATGCCGATGTGGATGCCGTACTGCGCGCGCCAGGAGCGTCGAGCGAGTTCTACCGG
GACCGGACGTGGGCCAACCGCCGCGGTGGTCCGGACAGCCCTCTCGTGCAGAGCGTACGA
AAATGGATGCTCATGCTCGACGGCCCGGCTCATCGACGGATCCGCGGTGCGATCAGCAAG
GTTTTCACCCGGGCCGCCGTGGAACGGCTGAGGCCACGCATAGCCGCCGAGACCGCCCGG
CTGCTCGACGCCGTGGGCGACGGCAAGACGGACCTCATCCACAGCCTCGCCCTGCCCCTT
CCGGTGACTGTGACCTGCGAACTTCTCGGTTTACCCGGAAGCGATCGAGACCAGTGCCGC
CGCTGGACGGAACAAATCAGCCGTGTGATCGACCCCTCGATAACCGCCGAGGACGCGGTC
GAGATGAACGCGGCGGAGGTGGAATTTCGGGAGTACGTCGCCGACCATCTCAAAGAGCGC
AGGTCGGCGCCGCGCGACGATATTCTCTCCCTCCTTCTGCACGCCGAGGTCGATGGCGGG
CGGCTGACCGAGGCGGAGATCATCGCCAATGTTCAGTTCTTGTTCGTCGCAGGCCATGAG
ACCACCGTCAATCTGATCGGAAACGGCCTCCTGGCGCTGCTCCGCCATCCCGACCAGTTG
CGCATGCTGCGCGACAACCCGGAAATCATCGCCGACTCCATCGATGAGATCACTCGATAC
GACCCTCCCGTGCAGATCGTCTCCAGGCTCCTGACCGAAGACGTCCCCTTGGCTGATGTC
ACCCTCCCCGCGGGCGCCAAGGTGATGCTGCTTTTCGGGGCGGCCAGTCGTGACCCGGAG
CGCTATCCCGATCCCGACCGCCTCGACCTGACCCGCACCGGGGTGAAAACGCTGGCCTTC
AGCGGTGGACCGCATTACTGCATCGGTGCCGCGCTGGGGAAGTTGGAGACCTCGATGGTG
CTGACGGAGTTGCTGCAGCGGTATTCCACGATCGAGCTCGCCGACGACGACCTGGTCTGG
CGTCCGAACGTCAGCTTCCGCGGTCTGCAGGAACTGCCGCTCCAACTGGTGTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [188-371]  6.70000000000001e-27 PF00067
PF00067   p450
 [16-396]  1e-96 SSF48264
SSF48264   Cytochrome_P450
 [6-396]  7.99999999999993e-112 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [86-97]  3.10001307370206e-46 PR00359 [131-147]  3.10001307370206e-46 PR00359 [148-163]  3.10001307370206e-46 PR00359 [191-213]  3.10001307370206e-46 PR00359 [272-283]  3.10001307370206e-46 PR00359 [289-316]  3.10001307370206e-46 PR00359 [317-332]  3.10001307370206e-46 PR00359 [338-347]  3.10001307370206e-46 PR00359 [347-358]  3.10001307370206e-46 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [340-349]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit