close all open/close all

CDS information : Meili_00070


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction17,671 / 19,389 / + [in whole cluster]
17,671 / 19,389 / + [in contig]
Location17671..19389 [in whole cluster]
17671..19389 [in contig]
TypeCDS
Length1,719 bp (572 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)AMP-dependent synthetase and ligase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf5

close this sectionSequence

selected fasta
>[AMP-dependent synthetase and ligase]
MQRSMRPALLAGQTLGESLTLLAKAAPDSRANFPTAGDDITAADLDIASAAAAHEFLRAG
VRPGDIVGVLVPTAARFFTTVFGLWRAGAAISVLPVQAGFGDPRDTARRLARIAEVAGLR
HLVLDPDYDELGHELTTMATGVALVSPPSPSATGSPLTLPTVDPDSLAIVQFTSGSTSLP
KGVMLHHRTTMAGLRACVVSGAFSPDDVFVQWVPTFHDMGLIGLQAHWLNGADVHAFSPT
TFLRRPGTVLEHFATHRGTVMTGPNFSYDYLLDRVPAERLAALDLSSWRLAFNGAEPVSS
ATVRRFTEALAPSGVGPSVMYPVYGMAEATLSISYPTPGDTPKFRTVDRDQLATTGVAHT
VDEAAAAAKPVVSVGRAVHGIELRIVGDDGAVAADGTLGEIQIAGEPVTTGYFRAPDATR
EVFDDGWLRTGDLGFLLDGELYVTGRRKEMVVVHGQNFFPDDVENVARTVPGVYRHRCVA
FSDTDAEGGERIGVIVETDADPAPVLAEVRRRVAAELDLSKVRVYAVKPRWIPRTTSGKW
QRVLAARRVAAADGDSAVAYPATGSPDRGERV
selected fasta
>[AMP-dependent synthetase and ligase]
GTGCAGCGATCCATGCGACCTGCCTTACTGGCCGGACAGACCCTGGGAGAAAGCCTGACC
CTGCTGGCGAAAGCCGCACCGGACTCCCGCGCGAATTTTCCCACTGCCGGCGACGACATC
ACCGCGGCGGACCTCGATATCGCTTCCGCCGCGGCGGCGCACGAGTTTCTGCGCGCCGGG
GTGCGGCCCGGTGACATCGTGGGCGTGCTGGTGCCCACCGCCGCCCGGTTCTTCACCACG
GTCTTCGGGCTCTGGCGGGCCGGTGCGGCGATCAGTGTGCTGCCGGTCCAGGCCGGTTTC
GGTGACCCGCGGGACACCGCGCGCCGCCTGGCGCGCATCGCGGAGGTCGCGGGCCTGCGC
CATCTCGTACTGGACCCCGACTACGACGAACTCGGCCACGAACTCACCACGATGGCCACT
GGGGTAGCCCTGGTGTCCCCGCCGTCGCCGAGCGCCACCGGCAGCCCGCTCACGCTGCCC
ACCGTCGATCCCGACTCGCTGGCCATCGTCCAGTTCACCTCCGGCAGCACCAGTCTGCCC
AAGGGCGTGATGCTGCACCATCGCACGACCATGGCCGGTCTGCGCGCCTGCGTGGTCTCG
GGCGCCTTCAGCCCGGACGATGTGTTCGTCCAGTGGGTGCCGACCTTCCACGACATGGGT
CTGATCGGCTTGCAGGCCCACTGGCTCAACGGGGCCGATGTCCACGCGTTCTCGCCGACC
ACCTTCCTCCGGCGGCCGGGCACGGTGCTCGAACACTTCGCGACACACCGCGGAACGGTG
ATGACCGGGCCCAACTTCTCCTACGACTATCTGCTCGACCGCGTGCCGGCGGAGCGACTT
GCCGCGCTCGACCTGTCCAGCTGGCGGCTGGCGTTCAACGGCGCCGAACCGGTCAGCTCG
GCCACCGTGCGGCGGTTCACCGAGGCACTGGCGCCCAGCGGCGTCGGCCCCTCGGTGATG
TACCCGGTGTACGGCATGGCCGAGGCCACCTTGTCGATCAGTTACCCGACGCCCGGAGAC
ACCCCGAAGTTCCGTACGGTGGACCGCGACCAGCTCGCCACGACCGGTGTCGCGCACACC
GTCGACGAGGCAGCGGCCGCGGCCAAGCCGGTGGTTTCGGTGGGCCGCGCGGTGCACGGC
ATCGAGCTGCGGATCGTCGGCGACGACGGGGCAGTGGCGGCCGACGGCACGCTCGGCGAG
ATCCAGATCGCCGGGGAGCCGGTGACCACGGGCTACTTCCGCGCCCCGGACGCGACACGC
GAGGTGTTCGACGACGGCTGGCTGCGCACCGGCGATCTCGGCTTCCTGCTCGACGGCGAG
CTGTACGTCACGGGGCGGCGCAAGGAAATGGTCGTGGTGCACGGGCAGAACTTCTTCCCC
GATGACGTGGAGAATGTCGCGCGCACCGTGCCGGGCGTCTACCGCCACCGCTGTGTCGCC
TTCTCCGACACCGATGCCGAGGGCGGCGAGCGGATCGGCGTCATCGTGGAGACCGATGCC
GACCCCGCCCCGGTGCTCGCGGAGGTCCGCAGAAGGGTGGCGGCCGAGCTGGACCTGTCC
AAGGTGCGGGTCTACGCAGTCAAACCCCGCTGGATCCCCCGCACCACCAGCGGAAAGTGG
CAGCGCGTACTGGCCGCGCGGCGGGTGGCCGCCGCTGACGGCGACAGCGCAGTGGCGTAC
CCCGCCACCGGAAGTCCAGACCGAGGAGAACGGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [41-473]  1.20000000000001e-86 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [170-181]  PS00455
PS00455   AMP_BINDING
SignalP
 [1-25]  0.422 Signal
Bacteria, Gram-positive   
 [1-25]  0.824 Signal
Eukaryota   
 [1-23]  0.637 Signal
Bacteria, Gram-negative   
TMHMM No significant hit