close all open/close all

CDS information : Meili_00080


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction19,386 / 20,252 / + [in whole cluster]
19,386 / 20,252 / + [in contig]
Location19386..20252 [in whole cluster]
19386..20252 [in contig]
TypeCDS
Length867 bp (288 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf6

close this sectionSequence

selected fasta
>[hypothetical protein]
MNSRTQSPAGVPLLADDRMHSARVFADYQHATWELHHIPWEEFRPDLVLPEHIVFAKGAI
VGESNVIAATHGLLNEFAMDYDFSQFACIWGYQEIQHHLAFQTWLQLAGHGIDHRTIASM
REAYPPGVTRAATLATNVICEVLATHAYKCVARTMKEPLLAAILKKASGDEARHAREFVH
YTAEQLAARPQECASVVETLYIYMGTTRDMYRHPVSRFKGNLPELENHETIDEMFAYFAE
VDEDGKEWTKCCEQLFKYFSALTGHKLTKMSDVRRAIAEESLNSKVPA
selected fasta
>[hypothetical protein]
GTGAACAGCAGAACACAGTCACCGGCCGGGGTCCCCCTGCTCGCGGACGACCGGATGCAC
AGCGCCCGGGTGTTCGCCGACTATCAGCACGCCACCTGGGAGCTGCACCACATCCCGTGG
GAGGAGTTCCGGCCCGATCTGGTGTTACCCGAGCACATCGTGTTCGCCAAGGGGGCCATC
GTGGGCGAGTCGAACGTCATCGCCGCGACCCACGGCCTGCTCAACGAGTTCGCCATGGAC
TACGACTTCTCGCAGTTCGCCTGCATCTGGGGCTATCAGGAGATCCAACACCATCTCGCC
TTCCAGACCTGGCTGCAGCTGGCGGGCCATGGCATCGACCACCGGACGATCGCCTCGATG
CGCGAGGCGTACCCGCCGGGAGTCACCAGGGCGGCCACCCTGGCCACCAACGTCATCTGC
GAGGTCCTTGCCACACACGCGTACAAATGCGTCGCCCGCACCATGAAGGAACCGCTCCTC
GCCGCCATCCTGAAGAAGGCCAGCGGCGACGAGGCGCGCCACGCACGCGAGTTCGTCCAC
TACACCGCGGAACAGCTGGCCGCACGGCCACAGGAGTGCGCGTCGGTCGTGGAAACCCTG
TACATCTACATGGGCACCACCCGCGACATGTACCGCCATCCGGTCAGCCGGTTCAAGGGA
AACCTGCCCGAACTGGAGAACCACGAGACCATCGACGAGATGTTCGCCTACTTCGCCGAG
GTCGACGAGGACGGCAAGGAATGGACGAAGTGCTGTGAGCAGCTGTTCAAGTACTTCTCC
GCGCTCACCGGCCACAAGCTGACCAAGATGTCCGATGTGCGGCGGGCGATCGCCGAGGAG
TCGCTGAACAGCAAGGTCCCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009078 Ferritin/ribonucleotide reductase-like (Domain)
 [24-214]  1.99999636034521e-25 SSF47240
SSF47240   Ferritin/RR_like
IPR012348 Ribonucleotide reductase-related (Domain)
 [81-198]  4e-05 G3DSA:1.10.620.20
G3DSA:1.10.620.20   Ribncl_red_rel
SignalP
 [1-26]  0.09 Signal
Eukaryota   
 [1-26]  0.094 Signal
Bacteria, Gram-negative   
TMHMM No significant hit