close all open/close all

CDS information : Meili_00090


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction20,249 / 20,779 / + [in whole cluster]
20,249 / 20,779 / + [in contig]
Location20249..20779 [in whole cluster]
20249..20779 [in contig]
TypeCDS
Length531 bp (176 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)thioesterase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf7

close this sectionSequence

selected fasta
>[thioesterase]
MSTAQHTAGEAIELPWHAEPSFNCFGCSPRNPIGLKLSLKRLPNGDHAAETSFSENYASY
PGIVHGGIVNVLLDEVMGDTLALVHGLLAFSVTLRSKMLLPLAVGEPYLTVARISGRGNG
VLHTQAEITGSDGELHVMATGTYQPIRSEQARKLMQLDDAAFGRVQHYFDHGTGES
selected fasta
>[thioesterase]
ATGAGCACCGCACAGCACACCGCCGGTGAGGCGATCGAACTCCCCTGGCACGCGGAGCCC
TCCTTCAACTGCTTCGGCTGCTCGCCGCGCAACCCCATCGGGCTCAAGCTGAGTCTGAAG
CGGCTGCCGAACGGGGACCACGCCGCCGAGACCTCCTTCTCGGAGAACTACGCCTCCTAC
CCGGGAATCGTGCACGGCGGCATCGTGAACGTGCTGCTGGACGAGGTGATGGGCGACACC
CTCGCCCTGGTGCACGGCCTGCTCGCCTTCTCCGTGACCCTGCGCAGCAAGATGCTGTTG
CCGCTCGCGGTGGGCGAGCCGTATCTGACCGTCGCGCGGATCAGCGGCCGGGGCAACGGA
GTGCTGCACACCCAGGCCGAGATCACCGGGTCCGACGGCGAACTGCACGTCATGGCCACC
GGCACCTACCAGCCGATCCGCTCCGAACAAGCCAGGAAACTCATGCAGCTCGACGATGCC
GCCTTCGGCCGCGTCCAGCACTACTTCGACCACGGTACGGGAGAGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-48]  0.296 Signal
Bacteria, Gram-positive   
TMHMM No significant hit