close all open/close all

CDS information : Meili_00100


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction20,776 / 21,066 / + [in whole cluster]
20,776 / 21,066 / + [in contig]
Location20776..21066 [in whole cluster]
20776..21066 [in contig]
TypeCDS
Length291 bp (96 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)acyl carrier protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf8

close this sectionSequence

selected fasta
>[acyl carrier protein]
MTAEPTGHEPTSRAQIAAVTIEYLATELEVSPAEIGLSDPLKALPGADSMKLLRVVSKLE
RQWDIEFDDQAVFAADTVDELVTLVHNYVSGELTTP
selected fasta
>[acyl carrier protein]
ATGACCGCCGAACCCACCGGCCACGAGCCCACCAGCCGCGCGCAGATCGCCGCGGTCACC
ATCGAATACCTCGCCACCGAACTGGAGGTCTCCCCCGCCGAGATCGGCCTCAGCGACCCC
CTCAAGGCGCTGCCCGGCGCCGACTCGATGAAACTGCTGCGGGTGGTCTCCAAACTGGAG
CGCCAGTGGGACATCGAGTTCGACGACCAGGCCGTCTTCGCCGCCGACACCGTCGACGAA
CTGGTCACTCTGGTGCACAACTACGTCAGCGGAGAACTGACGACACCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [12-91]  4.5e-14 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [46-86]  PS50075
PS50075   ACP_DOMAIN
 [22-85]  7.3e-08 PF00550
PF00550   PP-binding
 [9-92]  5.50000546509999e-14 SSF47336
SSF47336   ACP_like
SignalP No significant hit
TMHMM No significant hit