close all open/close all

CDS information : Meili_00110


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction21,063 / 21,932 / + [in whole cluster]
21,063 / 21,932 / + [in contig]
Location21063..21932 [in whole cluster]
21063..21932 [in contig]
TypeCDS
Length870 bp (289 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)cyclopropane-fatty-acyl-phospholipid synthase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf9

close this sectionSequence

selected fasta
>[cyclopropane-fatty-acyl-phospholipid synthase]
MTTVTPQAAYQATNKHYELPAELFAIYLDRRLKYSSGLYTDQNTDLDQAQTDKLHFVARQ
LGLTGGERLLDIGCGWGSLILFMAQEYGCHATGVTPSRPQLEYIRAQAEAAGVADLITLE
HGSFSDIEVAGPYDAITMLGSIVHMPNRTAVLRTVHELLRRGGSLYLSESCFRNSAAYEE
FSRRPGTKHVTEDIFGFADMVPLSTLVEAVESAGFSLTALSDLTAHYHRTIEDWEQRVHA
ARDRVERAAPGMSEPLIRYLRTANAGWGYTTKHYALSARKSRMGPTEAP
selected fasta
>[cyclopropane-fatty-acyl-phospholipid synthase]
ATGACCACCGTGACCCCCCAAGCGGCGTACCAGGCCACCAACAAGCACTACGAGCTGCCC
GCTGAGCTGTTCGCCATCTACCTCGACCGGCGGCTCAAGTACAGCTCCGGGCTGTACACC
GACCAGAACACCGACCTCGACCAGGCACAGACCGACAAACTGCACTTCGTCGCGCGGCAG
CTCGGTCTCACCGGCGGTGAGCGGCTGCTCGACATCGGCTGCGGCTGGGGCAGCCTGATC
CTGTTCATGGCCCAGGAGTACGGCTGCCACGCCACCGGTGTGACGCCGTCCCGCCCCCAG
CTCGAGTACATCCGGGCCCAGGCGGAGGCGGCGGGCGTGGCGGACCTGATCACGCTGGAG
CACGGCTCCTTCAGCGATATCGAGGTGGCCGGGCCGTACGACGCGATCACCATGCTCGGC
TCGATCGTGCATATGCCGAACCGGACGGCGGTGCTGCGCACGGTCCACGAACTGCTGCGC
CGCGGCGGATCGCTGTATCTGTCGGAAAGCTGCTTCCGGAACAGCGCCGCCTACGAGGAG
TTCTCACGGCGGCCGGGCACCAAGCACGTCACCGAGGACATCTTCGGATTCGCCGATATG
GTGCCGCTCTCCACGCTTGTGGAGGCCGTGGAGTCGGCCGGTTTCAGCCTCACCGCGCTC
TCCGATCTCACCGCGCACTACCACCGCACCATCGAGGACTGGGAACAACGGGTCCACGCC
GCGCGTGACCGCGTCGAACGGGCGGCACCGGGCATGAGCGAGCCACTGATCCGCTATCTT
CGGACGGCCAACGCCGGCTGGGGCTACACGACCAAGCACTACGCGCTCAGCGCACGGAAG
TCCCGGATGGGCCCGACGGAGGCACCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003333 Mycolic acid cyclopropane synthase (Family)
 [8-249]  1e-43 PF02353
PF02353   CMAS
SignalP No significant hit
TMHMM No significant hit