close all open/close all

CDS information : Meili_00120


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction21,929 / 22,801 / + [in whole cluster]
21,929 / 22,801 / + [in contig]
Location21929..22801 [in whole cluster]
21929..22801 [in contig]
TypeCDS
Length873 bp (290 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)acyl-[acyl-carrier protein] desaturase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf10

close this sectionSequence

selected fasta
>[acyl-[acyl-carrier protein] desaturase]
MSDTAPPVSSPEPLRPSLHPAELGKLTRKAVSRADTHHWSIEELPWKALRPEELTETDRS
VVRFITFIEDHIPGYLTYFLDAFPVSGEDLAIEEFCFNREYFRFLISWANEEERHASVLT
RYQIEAGISDPDTLLRELAEEGRKKFSLPYESPVQAFTYTLVQEKATQLFYQRFKAVATE
PVLRELLHRLARDEARHFAFYTEILTAYITRHGLAATIPDLKDVLSTFRMPLADTLNGYW
RWSLRVADAVSYNHTEAYGALIRLVNNFSTTKGGASTADLAEFIHRIRAV
selected fasta
>[acyl-[acyl-carrier protein] desaturase]
ATGAGCGACACCGCCCCGCCCGTATCCTCTCCGGAACCGCTCCGGCCCTCCCTCCACCCC
GCGGAGCTCGGCAAGCTCACCCGGAAGGCGGTGAGCCGCGCCGATACCCACCACTGGTCC
ATCGAAGAGCTGCCCTGGAAAGCACTGCGGCCGGAAGAACTCACCGAGACCGACCGCTCG
GTCGTGCGGTTCATCACCTTCATCGAGGACCACATTCCCGGGTATCTCACTTATTTCCTG
GACGCCTTCCCGGTGTCCGGTGAGGACTTGGCCATCGAGGAGTTCTGCTTCAACCGCGAG
TACTTCCGGTTTCTGATCTCGTGGGCGAACGAGGAGGAGCGGCACGCCTCGGTCCTGACC
AGATATCAAATCGAGGCCGGTATCAGCGACCCGGACACACTGCTCCGGGAGCTGGCCGAG
GAAGGCAGAAAGAAGTTCTCACTGCCTTACGAGAGCCCGGTCCAGGCATTCACCTACACA
CTGGTCCAGGAAAAGGCCACGCAACTTTTCTACCAGCGGTTCAAGGCGGTCGCCACCGAA
CCGGTGCTGCGCGAACTGCTTCACCGGCTGGCCAGGGACGAGGCCCGGCACTTCGCGTTC
TACACCGAAATCCTCACCGCCTACATCACACGGCACGGACTCGCCGCGACAATACCGGAC
CTCAAAGACGTGCTCTCCACCTTCCGTATGCCCCTGGCGGACACGCTCAACGGATACTGG
CGGTGGTCACTGCGCGTCGCGGATGCCGTGTCGTACAACCACACCGAGGCGTACGGCGCC
CTGATCCGGCTCGTCAACAACTTCAGCACCACAAAAGGCGGCGCGTCGACAGCTGACCTG
GCCGAGTTCATCCACCGCATCCGTGCCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005067 Fatty acid desaturase, type 2 (Family)
 [106-231]  1.8e-09 PF03405
PF03405   FA_desaturase_2
IPR009078 Ferritin/ribonucleotide reductase-like (Domain)
 [39-282]  4.10001399699315e-41 SSF47240
SSF47240   Ferritin/RR_like
IPR012348 Ribonucleotide reductase-related (Domain)
 [50-269]  7.79999999999999e-37 G3DSA:1.10.620.20
G3DSA:1.10.620.20   Ribncl_red_rel
SignalP No significant hit
TMHMM No significant hit