close all open/close all

CDS information : Meili_00130


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction24,429 / 22,816 / - [in whole cluster]
24,429 / 22,816 / - [in contig]
Locationcomplement(22816..24429) [in whole cluster]
complement(22816..24429) [in contig]
TypeCDS
Length1,614 bp (537 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)secreted amidase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf11

close this sectionSequence

selected fasta
>[secreted amidase]
MREQSVRKRSAATLIAALVAASLVAGAPNPRVEASEAGVDVSPPAGVSAGPGVDLDTVTI
PELQARLADGSLTSTALTTAYLRRIEAVDPKIHAVLRTDPTALRQAAASDTRHRSGDTRG
PLDGIPVLLKDNVNTRDMPTTAGSLALAGSPPDVDAALVTRLRNAGAVILGKTNLSEWAN
FRAAKPTSGWSAVGGQTNNPYVLDRNPCGSSAGSGAALAASLAQVAIGTETDGSIVCPAG
MNGVVGHKPSLGLVSQAGVVPISAEQDTAGPMARNVTDTALILSVISGTSRPGGPGGLAD
ELTHPSSLRGKRIGLWRLPSLGPQVDALMTRTAEKLRTAGAEVVEVTPPYQQRLAELEFP
ALLSEFHRDIDAYLATRDGPRNLAELVEFNRTHPAERICFAGQELFEQALAAPPTTDPGY
RAMRAELKDLSRRSIDETMAAHRLDAIAAPTNPPAWTTDCARGDNDVIPSSTPAAVSGYP
SLSVPSGFVDELPVGLLLMAGDHQDAGLLSLGAAVEHRLHAWRAPRYLPTVGPDASR
selected fasta
>[secreted amidase]
GTGAGGGAGCAGAGCGTGAGGAAACGGAGCGCTGCCACGCTGATCGCCGCCCTGGTCGCG
GCGTCCCTCGTCGCCGGGGCGCCGAATCCGCGTGTGGAAGCCTCCGAAGCCGGTGTCGAT
GTGTCGCCGCCGGCCGGTGTGTCCGCGGGGCCGGGGGTCGACCTCGACACGGTGACGATC
CCGGAATTACAGGCTCGTTTGGCGGACGGTTCACTGACCTCTACGGCGCTGACCACCGCC
TACCTGCGGCGGATCGAGGCCGTCGACCCCAAGATCCACGCGGTGTTGCGCACCGACCCG
ACGGCGTTGCGGCAGGCGGCCGCCAGCGACACAAGGCATCGGAGCGGCGACACCCGTGGC
CCGCTCGACGGTATCCCCGTCCTGCTCAAGGACAACGTGAACACCCGCGATATGCCCACG
ACGGCCGGGTCGCTGGCGCTGGCCGGCAGCCCGCCGGACGTGGACGCCGCCCTGGTGACC
CGGCTGCGGAACGCGGGGGCGGTGATCCTCGGCAAGACCAACCTGTCCGAGTGGGCGAAC
TTCCGCGCGGCCAAGCCCACATCGGGGTGGTCGGCGGTGGGTGGGCAGACCAACAACCCC
TACGTGCTGGACCGGAATCCCTGCGGGTCCTCCGCCGGTTCGGGCGCCGCGCTCGCCGCG
TCGTTGGCGCAGGTGGCGATCGGCACCGAGACGGACGGCTCCATCGTGTGCCCGGCCGGG
ATGAACGGGGTGGTCGGCCACAAGCCCAGCCTCGGGCTGGTCAGCCAGGCCGGGGTGGTC
CCGATCTCCGCCGAGCAGGACACCGCGGGGCCCATGGCGCGCAATGTGACCGACACCGCG
CTCATCCTGTCCGTGATCAGCGGCACCTCACGTCCTGGCGGCCCGGGCGGCCTCGCGGAC
GAGCTGACGCACCCCAGCAGTCTGCGCGGCAAACGGATCGGCCTGTGGCGGCTGCCGTCG
CTCGGGCCGCAGGTGGACGCCCTGATGACCCGTACCGCCGAGAAACTGCGCACCGCGGGG
GCCGAGGTCGTCGAGGTGACACCTCCGTATCAGCAGCGCCTCGCCGAACTCGAATTCCCG
GCGCTGCTGAGCGAGTTCCACCGGGACATCGACGCCTATCTCGCCACCCGCGACGGGCCG
CGCAACCTCGCCGAGCTGGTCGAGTTCAACCGCACCCATCCGGCGGAGCGGATCTGCTTC
GCCGGTCAGGAGCTGTTCGAGCAGGCGCTTGCCGCGCCTCCCACCACCGACCCGGGATAC
CGGGCCATGCGCGCCGAGTTGAAGGACCTTTCCCGGCGTTCCATCGACGAGACCATGGCG
GCCCATCGGCTGGACGCCATCGCGGCCCCCACGAACCCGCCCGCCTGGACGACCGACTGT
GCGCGGGGCGACAACGATGTGATCCCGTCCTCAACGCCCGCGGCCGTGTCCGGATACCCG
TCGTTGTCGGTGCCCTCCGGGTTCGTGGACGAGCTGCCCGTGGGCCTGCTGCTGATGGCC
GGTGACCACCAGGATGCGGGGCTTCTGTCGCTGGGGGCGGCGGTGGAGCACCGGCTGCAC
GCGTGGCGAGCGCCGCGCTATCTGCCGACGGTGGGGCCCGACGCCTCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000120 Amidase (Family)
 [77-509]  3.30000000000002e-103 PF01425
PF01425   Amidase
IPR023631 Amidase signature domain (Domain)
 [52-529]  5.29997329885557e-112 SSF75304
SSF75304   Amidase_sig_enz
 [55-528]  G3DSA:3.90.1300.10
G3DSA:3.90.1300.10   Amidase_sig_enz
SignalP
 [1-26]  1 Signal
Bacteria, Gram-negative   
 [1-26]  0.993 Signal
Eukaryota   
 [1-34]  1 Signal
Bacteria, Gram-positive   
TMHMM No significant hit