close all open/close all

CDS information : Meili_00140


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction25,007 / 24,504 / - [in whole cluster]
25,007 / 24,504 / - [in contig]
Locationcomplement(24504..25007) [in whole cluster]
complement(24504..25007) [in contig]
TypeCDS
Length504 bp (167 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf12

close this sectionSequence

selected fasta
>[hypothetical protein]
MSMIGEYARLTPAELERAVRDPDWGREFIGELAETEPDEGPGASQPRCFDTDKAWHALDF
LLRRLAFPVDVVFGEEEISGADGWGHGPPCYLTPERVRVAAEALAAMPAEALVSGVTPDD
LVQADIYPDSVWVGDESLDYVTNYYQALVPFFQVAARDGHAMVIWID
selected fasta
>[hypothetical protein]
ATGAGCATGATCGGAGAGTACGCGCGTCTCACCCCGGCTGAACTCGAGCGCGCGGTCCGC
GACCCGGACTGGGGCAGGGAGTTCATCGGCGAGCTGGCCGAAACCGAGCCTGACGAGGGG
CCAGGGGCGTCACAGCCGCGCTGCTTCGACACCGACAAGGCATGGCACGCCCTCGACTTC
CTGCTGCGCCGCCTCGCGTTTCCCGTGGACGTCGTCTTCGGTGAGGAGGAAATCTCCGGG
GCCGACGGCTGGGGCCACGGGCCTCCCTGCTATCTCACGCCGGAGCGTGTGCGGGTGGCG
GCTGAGGCGCTCGCGGCGATGCCTGCGGAGGCCTTGGTCAGCGGGGTCACTCCGGACGAT
CTCGTCCAGGCCGATATCTATCCCGACAGCGTCTGGGTGGGCGACGAGTCGCTGGACTAT
GTGACCAACTACTACCAGGCGCTGGTTCCGTTCTTCCAGGTGGCTGCCCGCGACGGGCAC
GCCATGGTCATCTGGATCGACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR015068 Protein of unknown function DUF1877 (Family)
 [1-166]  7.90000000000001e-22 PF08974
PF08974   DUF1877
 [3-167]  2.10000267834031e-18 SSF111069
SSF111069   DUF1877
SignalP No significant hit
TMHMM No significant hit