close all open/close all

CDS information : Meili_00150


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction25,161 / 27,209 / + [in whole cluster]
25,161 / 27,209 / + [in contig]
Location25161..27209 [in whole cluster]
25161..27209 [in contig]
TypeCDS
Length2,049 bp (682 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)alpha-glucuronidase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf13

close this sectionSequence

selected fasta
>[alpha-glucuronidase]
MTASASVTVPVPALPSGVDSAWLPPEVFRPLGSRRTLILGTGPLVDTVHGEVADACARFG
GDVVRDARAQGAPYDLVLELGRQSEEEDGLGDEGFALVRAEGVTRVTAAGQAGLLYGLFH
LVRLGEAAFEGERARETHRPALALRMLDHWDNVAVHPVMGQVERGYSGGSLFWRDGLARG
SRDELERVRCYGRLLAASGINAVTVNNVNVHETEAHLLTDRIGEVAAIADALRPYGIRTH
LSVSFAAPVVLGGLPTADPLDAAVADWWAETTGRVYAAIPDFGGYVVKADSEGQPGPFTY
GRSHADGANMLAAALAPYGATVHWRAFVYNHRQDWRDRSVDRARAAYDHFAPLDGQFAPN
AVLQVKHGPMDFQTREPVSPVIGALPNTRLAVEIQATQEYTGQQKHVCWLGPMWSDALRF
RRGGEDGPSVGDLVRGGGLAAVSSAGDDPFWTGHPLAQANLYAVGRLAWQPDADPRAILH
EWIELSFAPEETADPARLRSGLRAVLDGSWRTYEKYTAPLGIGFMVQPGHHYGPSVDGYE
YSPWGTYHFADRDGVGVDRSQATGTGYAGQYAKPWAETYESPETCPDELLLFFHHVPYGH
VLHSGETVIQHIYDTHFEGVEEVEEARQVWAGLADLVDAARHTRVAERYEEQLRSAREWR
DHINTYFFRKSGVPDARGRRIY
selected fasta
>[alpha-glucuronidase]
GTGACAGCATCCGCATCCGTTACCGTCCCTGTGCCCGCGCTGCCCAGCGGCGTGGACTCG
GCGTGGCTGCCGCCCGAGGTGTTCCGCCCGCTCGGTTCCCGGCGCACGCTGATCTTGGGA
ACGGGCCCGCTGGTGGACACGGTGCACGGAGAAGTGGCCGACGCCTGCGCACGGTTCGGT
GGGGATGTCGTACGGGACGCGCGGGCGCAGGGCGCGCCGTACGACCTGGTGCTGGAGCTC
GGTCGGCAGAGCGAGGAGGAGGACGGGCTCGGGGACGAGGGGTTCGCGCTGGTGCGGGCC
GAGGGCGTCACCCGGGTGACGGCCGCCGGTCAGGCCGGGCTGCTGTACGGGCTGTTCCAT
CTGGTGCGGCTCGGCGAGGCGGCCTTCGAGGGCGAGCGTGCCCGCGAGACGCACCGGCCG
GCGCTGGCCCTGCGGATGCTGGACCACTGGGACAACGTGGCGGTGCATCCGGTGATGGGC
CAGGTGGAGCGGGGGTACTCGGGTGGCTCGCTGTTCTGGCGGGACGGTCTGGCCCGGGGC
TCGCGGGACGAGTTGGAGCGGGTGCGCTGCTACGGCAGGCTGCTGGCCGCTTCCGGTATC
AACGCGGTCACCGTGAACAACGTCAATGTGCACGAAACCGAGGCGCATCTGCTGACCGAC
CGCATCGGCGAGGTGGCCGCGATCGCGGACGCGCTGCGCCCGTACGGGATCCGGACGCAT
CTGTCCGTCTCCTTCGCCGCGCCCGTCGTGCTCGGCGGCCTGCCCACCGCCGATCCGCTG
GACGCCGCGGTGGCCGACTGGTGGGCGGAGACGACCGGCCGGGTGTACGCGGCGATACCC
GACTTCGGCGGGTATGTGGTGAAGGCCGACTCCGAGGGCCAGCCCGGCCCGTTCACCTAC
GGCCGCAGCCACGCGGACGGCGCCAACATGCTGGCCGCGGCGCTCGCCCCGTACGGCGCC
ACGGTGCACTGGCGGGCCTTTGTGTACAACCATCGGCAGGACTGGCGGGACCGGTCGGTG
GACCGGGCACGTGCGGCCTACGACCACTTCGCACCCCTGGACGGCCAGTTCGCGCCCAAC
GCAGTGCTCCAGGTGAAACACGGCCCCATGGACTTCCAGACGCGCGAGCCCGTCTCCCCG
GTGATCGGCGCGCTGCCGAACACGCGGCTGGCGGTGGAGATACAGGCCACCCAGGAGTAC
ACCGGGCAGCAGAAGCATGTGTGCTGGCTCGGGCCGATGTGGAGCGACGCGCTGCGGTTC
CGGCGGGGCGGGGAGGACGGGCCGAGCGTCGGGGATCTGGTGCGCGGCGGCGGCCTGGCG
GCGGTGTCGAGCGCCGGTGACGACCCGTTCTGGACCGGACATCCGCTTGCACAGGCCAAC
CTGTACGCGGTCGGCCGTCTGGCCTGGCAGCCCGACGCGGACCCGCGCGCGATCCTGCAC
GAGTGGATCGAGCTGTCCTTCGCCCCCGAGGAGACCGCCGATCCCGCGCGGCTGCGCAGC
GGGCTGCGGGCCGTTCTGGACGGCTCCTGGCGGACGTACGAGAAGTACACGGCGCCGCTC
GGCATCGGCTTCATGGTGCAGCCCGGACATCACTACGGGCCCAGCGTGGACGGCTACGAG
TACAGCCCGTGGGGGACGTACCACTTCGCCGACCGGGACGGAGTCGGCGTCGACCGCAGC
CAGGCCACCGGCACCGGGTACGCGGGGCAGTACGCGAAGCCGTGGGCGGAGACGTACGAA
TCGCCCGAGACCTGCCCGGACGAGCTGCTGCTCTTCTTCCACCATGTGCCGTACGGACAT
GTGCTGCACAGCGGCGAAACGGTGATCCAGCACATCTACGACACACACTTCGAGGGCGTG
GAAGAGGTCGAGGAGGCACGACAGGTGTGGGCCGGGCTCGCGGACCTGGTGGATGCGGCA
CGCCACACCCGGGTCGCGGAACGCTACGAGGAGCAGCTTCGCAGCGCCCGGGAGTGGCGC
GACCACATCAACACGTACTTCTTCCGGAAGTCCGGCGTACCGGACGCCCGCGGGCGCCGC
ATCTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011099 Glycosyl hydrolase 67, C-terminal (Domain)
 [475-682]  6.20000000000009e-79 G3DSA:3.90.1330.10
G3DSA:3.90.1330.10   Glyco_hydro_67_C
 [452-681]  1.10000000000001e-89 PF07477
PF07477   Glyco_hydro_67C
IPR011100 Glycosyl hydrolase 67 middle (Domain)
 [132-451]  2.99999999999998e-125 PF07488
PF07488   Glyco_hydro_67M
IPR011395 Glycoside hydrolase, family 67, alpha glucuronidase (Family)
 [1-682]  PIRSF029900
PIRSF029900   Alpha-glucuronds
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [143-472]  G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [142-682]  SSF51445
SSF51445   Glyco_hydro_cat
SignalP
 [1-20]  0.834 Signal
Eukaryota   
TMHMM No significant hit