close all open/close all

CDS information : Meili_00160


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction31,071 / 27,238 / - [in whole cluster]
31,071 / 27,238 / - [in contig]
Locationcomplement(27238..31071) [in whole cluster]
complement(27238..31071) [in contig]
TypeCDS
Length3,834 bp (1,277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf14

close this sectionSequence

selected fasta
>[hypothetical protein]
MRQSAIAAGPTRRGVRPADTGECGVDKEYDDSGDRASVLRAWADMATRQANEVMRRPADD
PARTAALWQTIQHVAAIEKLLPADDPLRDGIVPSLGILMCVWLDSRGPGQQRDAARQARE
YTLHHLRWADRTRPLTDPLAVQARKALLWLLVPEHHARAMRALRHGPRQEPPLRASGPQP
LTASTRDELAEAIDVLKRLAEAPEDPQLLRLLGFVVSEIKLTVPEAVAPHEENTAEPTGT
APQEDADDGLDDALQAVFAWALEDIARFTGLLLWLSGAVYEVRISTEKADEELAVLGLDR
PVFAPLRELLAKLRSGEGDPRVLAESARRGADIARRALRELPADVPERARMAKLHAALLL
QANFLVPGMMDFDEVDEAVSEPDPDPASRFGGPGQVTLEQWLTSLIDAVRVQQTGDLAHL
ERGTARLREMIDGLSGEGEKAMPARQAVASALAGRVNAAAMLGGSFQAADAALTMARELR
AAYRRDGSPPSRDMVNAVVFASQQELALARRSDDPTLLPRLVEELTDLYATLPSDQENRF
AIAATLADAHQEQSARNQDPAELRAAARYLRDVVETDERRIAALLAPYFPAVRATAMIQL
IMIEPSREAADHAVAEVHRILEGPQPTPYQELQLRYQLGRALLHTARHLDDPGLLDQCIT
ELARVRELMAQGHGLPHNVDALTQLSEAYWLRRERHRPTAVEDVNASLAARGEALVRLAS
DVLLQLGSEHGLAVARTGAAQALWLAYWNTVIGRPADAVDALEMGRALVLRAAAASRGIP
ELLEARGHPDLARRWRAEVATDRLPSDAPDPLLGRSTERQIPGTLRRRALDVLGAGSGAD
ARRLLGPPDLAGLKAGLTAAGTDALVYLVLGLQPGQDGLALILRPDTGNAPPTVLKLPLL
TPGSPPLERYLDATARRSQATATATATATPTPTTADATAEPSGQAAPDGRWEAALRELCD
WAWPAAMGPVLAAVGPLNRPPRIVLVPCGALGAVAWHAARTPYGRNGRAHRYACEEAVLS
YAPSGAEFLRAAARDRLPIATGQVLVADPELSLLWAEIETEALRATCYPDGLCYGEFLTA
VSDAPGTPEDILAVLPGGSSPAAAVLHISCHALVGPYPTRSALWLATPPDGPQDAGRLTV
ARILDGTATGQPAAAGPLVVLSACETDLSTRNHDEALTLSTALIARGAADVIGSRWAVRD
ASTAVMMAVFHDFVTTHGLAPVDALRAAQLWMLDPHREPPPTLHDDLRGEAARIDLDQVH
LWAAFTHQGNPAAQSTV
selected fasta
>[hypothetical protein]
GTGCGGCAGTCGGCGATTGCCGCCGGCCCGACCCGCCGGGGCGTGCGGCCAGCGGACACG
GGGGAGTGCGGGGTGGACAAGGAGTACGACGACAGCGGGGACAGGGCGTCGGTGCTGCGC
GCCTGGGCCGACATGGCCACCCGCCAGGCCAATGAGGTGATGCGCCGACCAGCGGACGAC
CCGGCGCGGACCGCCGCGCTGTGGCAGACGATCCAGCATGTGGCCGCCATCGAAAAACTG
TTGCCCGCGGACGATCCGCTGCGGGATGGCATCGTTCCTTCGCTGGGCATCCTGATGTGC
GTCTGGCTCGACAGCCGTGGCCCGGGCCAACAGCGCGACGCGGCCCGGCAGGCACGGGAG
TACACCCTGCACCACCTGCGCTGGGCCGACCGCACCAGGCCGCTCACCGACCCGCTCGCG
GTGCAAGCCCGCAAGGCGCTGCTCTGGCTGCTCGTCCCGGAGCACCACGCGCGAGCCATG
CGCGCCTTGCGCCACGGTCCCCGTCAGGAGCCGCCGCTTCGCGCCTCCGGCCCGCAGCCG
CTGACCGCATCCACGCGGGATGAACTGGCGGAGGCCATAGACGTTCTCAAGCGCCTCGCC
GAGGCCCCGGAAGATCCGCAGCTGCTCCGACTGCTCGGATTCGTCGTGTCGGAGATCAAG
CTGACAGTGCCCGAGGCGGTGGCACCGCACGAGGAGAACACGGCGGAGCCGACGGGTACG
GCTCCTCAGGAAGACGCCGACGACGGGTTGGACGACGCCCTCCAGGCCGTGTTCGCCTGG
GCCTTGGAGGACATCGCTCGGTTCACGGGTCTTCTGCTGTGGCTGAGCGGCGCGGTGTAC
GAGGTCAGGATCTCCACCGAGAAGGCCGACGAGGAACTGGCGGTCCTGGGCCTGGACCGA
CCGGTCTTCGCGCCGCTGCGCGAGCTGCTGGCCAAGCTCAGGTCGGGCGAGGGCGACCCC
CGGGTGCTGGCCGAGAGCGCCCGGCGCGGCGCGGACATCGCCCGGCGGGCCCTGCGGGAG
TTGCCGGCGGACGTACCCGAACGGGCCCGCATGGCCAAACTGCATGCCGCTCTGCTGCTG
CAGGCCAACTTCCTGGTGCCCGGCATGATGGACTTCGACGAGGTGGACGAGGCCGTGTCG
GAGCCGGACCCCGACCCCGCCAGCCGTTTCGGCGGGCCGGGCCAGGTCACTCTGGAACAG
TGGCTGACCAGTCTGATCGATGCGGTACGGGTGCAGCAGACCGGCGATCTGGCACATCTG
GAGAGGGGCACCGCACGGCTCCGGGAGATGATCGACGGGCTGTCCGGGGAAGGCGAGAAG
GCCATGCCCGCCCGGCAGGCCGTGGCCAGCGCCCTGGCCGGGCGCGTCAACGCGGCGGCG
ATGCTCGGGGGCAGCTTCCAGGCCGCCGACGCCGCCCTGACGATGGCCAGGGAACTGCGC
GCCGCCTACCGCCGCGACGGCTCACCACCGTCCAGGGACATGGTCAACGCGGTGGTGTTC
GCGTCCCAACAAGAGCTGGCCCTGGCCCGCCGCAGCGACGACCCCACCCTGCTGCCGCGC
CTCGTCGAGGAGCTGACCGACCTGTACGCCACTCTGCCATCCGATCAGGAGAACCGCTTC
GCCATCGCCGCCACCCTGGCCGATGCCCATCAGGAACAGTCCGCCCGCAACCAGGACCCG
GCCGAACTCCGCGCCGCGGCCCGGTACCTCCGGGACGTGGTGGAGACCGATGAGCGGCGA
ATCGCGGCATTGCTCGCACCGTACTTCCCGGCCGTACGGGCCACCGCGATGATCCAACTG
ATCATGATCGAGCCCAGCCGGGAGGCCGCCGACCACGCCGTCGCGGAGGTCCACCGAATC
CTCGAGGGACCGCAGCCCACCCCCTACCAGGAACTCCAGCTGCGGTACCAACTCGGCCGG
GCCCTGCTGCACACCGCCCGCCACCTCGATGACCCGGGCCTGCTCGACCAGTGCATCACC
GAGCTGGCCCGGGTCCGCGAGCTGATGGCCCAGGGGCACGGCCTGCCGCACAACGTCGAT
GCCTTGACGCAACTGTCCGAGGCGTACTGGCTGCGCCGCGAGCGCCACCGTCCGACCGCG
GTCGAGGACGTGAACGCCAGCCTGGCCGCCCGAGGCGAGGCACTGGTCAGGCTCGCCTCG
GACGTCCTCCTCCAACTCGGCTCCGAACACGGCCTGGCCGTGGCCCGCACCGGGGCGGCG
CAGGCACTGTGGCTGGCCTACTGGAACACCGTGATCGGCCGCCCCGCCGATGCGGTGGAC
GCGCTGGAGATGGGCCGGGCCCTGGTGCTGCGCGCCGCGGCCGCGTCCCGCGGCATTCCC
GAGCTCCTCGAAGCCCGTGGCCACCCGGATCTGGCCCGGCGGTGGCGCGCCGAGGTCGCC
ACGGACCGGCTCCCGTCCGATGCCCCGGACCCGCTCCTGGGCCGGTCCACGGAGCGGCAG
ATCCCGGGCACCCTGCGCCGCCGGGCACTTGACGTGCTGGGCGCGGGCAGCGGCGCGGAC
GCCCGGAGACTGCTCGGCCCGCCGGACCTGGCAGGGCTGAAGGCCGGTCTCACCGCCGCC
GGCACCGATGCGCTCGTCTATCTCGTCCTCGGGCTCCAACCCGGTCAGGACGGCCTCGCA
CTGATCCTCCGCCCCGACACCGGCAACGCGCCGCCCACCGTCCTGAAGCTGCCGCTGCTG
ACCCCCGGCAGCCCGCCACTGGAGCGCTACCTCGACGCCACGGCCCGACGTTCCCAGGCC
ACCGCCACCGCCACCGCCACCGCCACCCCCACCCCCACCACCGCCGACGCCACGGCCGAG
CCGAGTGGGCAGGCGGCGCCGGACGGGCGTTGGGAGGCGGCGCTGCGTGAGCTGTGCGAC
TGGGCCTGGCCTGCCGCGATGGGCCCCGTCCTGGCCGCCGTGGGGCCGCTCAACCGGCCG
CCGCGGATCGTCCTGGTGCCCTGCGGAGCACTCGGCGCGGTCGCCTGGCACGCGGCGCGC
ACCCCGTACGGGCGCAACGGCCGCGCACACCGGTACGCCTGCGAGGAAGCGGTGCTCAGC
TACGCGCCCTCCGGAGCCGAGTTCCTGCGGGCCGCAGCCCGGGACCGGCTGCCCATCGCC
ACCGGACAGGTCCTGGTCGCCGACCCCGAACTCTCCCTCCTGTGGGCCGAGATCGAGACC
GAGGCGCTGCGCGCGACCTGCTACCCGGACGGCCTCTGCTACGGCGAGTTCCTCACGGCC
GTCAGCGACGCGCCGGGCACCCCGGAGGACATCCTCGCCGTCCTGCCCGGCGGCAGCTCC
CCGGCCGCCGCCGTCCTGCACATCTCCTGCCACGCCCTGGTCGGCCCGTATCCCACGCGC
TCGGCGCTCTGGCTCGCCACCCCGCCGGACGGCCCCCAGGACGCCGGACGGCTGACCGTG
GCCCGCATCCTGGACGGCACCGCCACCGGACAGCCGGCCGCCGCGGGCCCGTTGGTGGTG
CTCAGCGCCTGTGAGACGGATCTGAGCACCCGCAACCACGACGAGGCCCTGACCCTGTCC
ACGGCCCTGATCGCCCGCGGCGCCGCCGATGTCATCGGCTCGCGCTGGGCCGTCCGCGAT
GCCTCGACGGCTGTGATGATGGCCGTCTTCCATGACTTCGTCACCACCCACGGCCTCGCC
CCGGTGGACGCGCTGCGCGCCGCCCAGCTGTGGATGCTCGACCCGCACCGCGAGCCACCG
CCCACCCTCCATGACGATCTACGCGGCGAGGCCGCCCGCATCGACCTCGACCAGGTCCAT
CTCTGGGCCGCCTTCACCCATCAGGGCAACCCGGCGGCCCAGAGCACGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR024983 CHAT domain (Domain)
 [965-1270]  4.5e-37 PF12770
PF12770   CHAT
SignalP
 [1-7]  0.452 Signal
Bacteria, Gram-negative   
TMHMM No significant hit