close all open/close all

CDS information : Meili_00170


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction32,580 / 31,153 / - [in whole cluster]
32,580 / 31,153 / - [in contig]
Locationcomplement(31153..32580) [in whole cluster]
complement(31153..32580) [in contig]
TypeCDS
Length1,428 bp (475 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)gluconate transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf15

close this sectionSequence

selected fasta
>[gluconate transporter]
MTAHTWWLLAILTVAITALIYLINSRLRVHPFVALIVVTVATGLAAGEPVAKLIDSIEEG
AGGTLGDVGVTLALGAMLGRLLSDSGATDAIARGLVERADTRRLPWLVGAVAFVIGIPMF
FEVGLIVLLPLIFSVARRLEDQGGTKGSPYVLLGVPAIASLSTLHGMLPPHPGPLTAMTG
LHADLGLTLVVGVVCAIPTVILAGPVYARWIAPRLPEVRPDAELVAQFTGTGRGPAAPSS
GPGAQTRPDAGPRSGVSIGLAVAAVLVPVALMLLRTLAETLLDESSGLRAGLAFAGEPLV
AMLAGVLFALGVTIVGGGRSGEETHASLTNSLKSIAAILLIIGGGGAFKQVLQDSGIGDA
IASAAEGAHINVILLGWLIALLLSLTTGSATVGIVSATGIVAPLIGGGGGLEASLLVVAI
GAGSLGLNYVNHAGFWLVKESFGMDLAQAAKTQTVVQTLVSVLGLLMALLLSVFV
selected fasta
>[gluconate transporter]
ATGACCGCACACACCTGGTGGCTGCTGGCGATCCTCACGGTGGCGATCACCGCACTGATC
TACCTGATCAACTCACGGCTGCGCGTCCACCCCTTCGTCGCACTGATCGTCGTGACCGTC
GCCACCGGACTCGCGGCCGGCGAACCGGTGGCCAAACTGATCGATTCGATCGAGGAAGGC
GCGGGCGGCACCCTCGGGGACGTCGGTGTCACGCTGGCGCTGGGCGCCATGCTGGGCAGA
CTGCTGTCCGACTCCGGAGCCACCGACGCCATCGCCCGCGGCCTCGTCGAACGGGCCGAC
ACCCGCAGGCTGCCCTGGCTGGTCGGCGCGGTGGCGTTCGTCATCGGCATCCCGATGTTC
TTCGAGGTGGGCCTGATCGTCCTGCTGCCGCTGATCTTCAGCGTGGCCCGTCGGCTCGAG
GACCAGGGCGGCACCAAGGGCAGCCCGTACGTCCTGCTCGGCGTCCCGGCCATCGCCTCC
CTGTCCACCCTGCACGGCATGCTGCCGCCCCACCCCGGCCCGCTGACCGCCATGACCGGC
CTGCACGCCGACCTCGGCCTCACCCTCGTCGTCGGCGTCGTCTGCGCCATCCCCACCGTC
ATCCTGGCCGGCCCCGTCTACGCCCGCTGGATCGCGCCTCGGCTGCCCGAGGTCCGCCCG
GACGCCGAACTCGTGGCCCAGTTCACCGGCACCGGACGGGGACCCGCGGCGCCTTCCTCG
GGGCCCGGCGCGCAGACGCGTCCGGACGCGGGTCCCCGCTCCGGCGTGTCCATCGGGCTG
GCCGTGGCTGCCGTGCTCGTTCCGGTCGCGCTCATGCTGCTGCGCACCCTGGCCGAAACG
CTGCTCGACGAGTCCAGCGGGCTGCGCGCCGGCCTCGCCTTCGCGGGGGAACCGCTGGTG
GCGATGTTGGCCGGTGTGCTCTTCGCGCTCGGAGTGACCATCGTCGGCGGTGGCCGCTCG
GGGGAGGAGACCCACGCCTCCCTGACCAACAGCCTCAAGTCCATCGCCGCGATCCTCCTC
ATCATCGGCGGCGGGGGCGCGTTCAAGCAGGTCCTTCAGGACTCGGGGATCGGCGACGCC
ATCGCGTCGGCCGCCGAGGGAGCGCATATCAACGTGATCCTGCTGGGCTGGCTCATCGCG
CTGCTGCTGTCGCTGACCACGGGCTCGGCCACCGTCGGCATCGTCTCCGCGACCGGCATC
GTGGCTCCGCTGATCGGTGGCGGCGGAGGCCTGGAGGCGTCGCTTCTCGTGGTCGCGATC
GGCGCCGGCTCCCTCGGCCTCAACTACGTCAACCACGCCGGCTTCTGGCTGGTGAAGGAG
TCGTTCGGCATGGATCTCGCTCAGGCCGCCAAGACTCAGACCGTCGTCCAGACCCTGGTC
AGCGTGCTCGGCCTGCTCATGGCCCTGCTGCTGTCGGTGTTCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003474 Gluconate transporter (Family)
 [1-475]  PIRSF002746
PIRSF002746   Gluconate_transporter
 [9-473]  3.60000000000002e-117 PF02447
PF02447   GntP_permease
 [11-475]  5.40000000000002e-114 TIGR00791
TIGR00791   GntP
SignalP
 [1-25]  0.699 Signal
Eukaryota   
TMHMM
 [5-22]  Transmembrane (o-i) [29-51]  Transmembrane (i-o) [61-83]  Transmembrane (o-i) [104-126]  Transmembrane (i-o) [185-207]  Transmembrane (o-i) [255-277]  Transmembrane (i-o) [292-314]  Transmembrane (o-i) [326-348]  Transmembrane (i-o) [373-395]  Transmembrane (o-i) [400-422]  Transmembrane (i-o) [452-474]  Transmembrane (o-i)
Transmembrane 11