close all open/close all

CDS information : Meili_00180


close this sectionLocation

Organism
StrainNS3226
Entry nameMeilingmycin
Contig
Start / Stop / Direction33,654 / 32,668 / - [in whole cluster]
33,654 / 32,668 / - [in contig]
Locationcomplement(32668..33654) [in whole cluster]
complement(32668..33654) [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in meilingmycin biosynthesis.
Note (GenBank)
  • orf16

close this sectionSequence

selected fasta
>[hypothetical protein]
MRGRTRALSGTVALLLSLVLGGCGAWPDTGAADDGLRILVPNTAGGGYDTTARTVARVLE
ETGTASDVQVFNLPGAGGTVGLQRTVNERGNGRLALQMGLGVLGASHVVHARVTVRQTTP
IARLIEEPEAVVVRKDSPYRTVEDLVTAWRTGPRRVRVGGGSSLGGPDHLFPMELARTVG
IAPRQVRYVAYDGGGGDLLPALLDGRVDFATSGIGEFLDQIQAGQLRVLAVTSDRPVAAL
PGVPTLKASGIDLVFHNWRGIVAPPGISPEDRKRWIRALTALHSSRQWKAELIRHGWTDA
FITGGAFGAYLKRQDAAVADLAARLGLD
selected fasta
>[hypothetical protein]
ATGAGAGGACGTACCCGAGCCCTGTCGGGCACCGTAGCCCTCCTGCTCTCGCTGGTTCTC
GGCGGCTGTGGTGCATGGCCGGACACCGGGGCGGCCGATGACGGCCTGCGCATCCTGGTG
CCCAACACGGCCGGGGGCGGATACGACACCACGGCCCGGACCGTGGCCCGTGTGCTGGAG
GAAACCGGCACCGCCTCGGATGTGCAGGTGTTCAACCTGCCGGGCGCCGGTGGAACGGTG
GGTCTCCAGCGGACCGTCAACGAACGCGGCAACGGCCGGCTCGCCCTCCAGATGGGCCTC
GGGGTCCTCGGCGCGTCGCATGTCGTGCACGCGCGGGTGACCGTACGGCAGACCACCCCG
ATCGCACGCCTCATCGAGGAGCCCGAGGCGGTGGTGGTCCGCAAGGACTCGCCGTACCGC
ACGGTCGAGGACCTGGTCACCGCGTGGCGGACGGGCCCGCGGCGGGTCAGGGTCGGTGGC
GGCTCCTCTCTGGGCGGTCCGGACCACCTGTTCCCCATGGAGCTGGCCAGGACCGTCGGA
ATCGCTCCCCGGCAGGTGAGGTACGTCGCCTACGACGGCGGTGGCGGCGATCTGCTGCCC
GCGCTGCTTGACGGCAGGGTCGACTTCGCCACCAGCGGCATCGGTGAGTTCCTGGACCAG
ATCCAGGCAGGCCAGCTGCGGGTGCTCGCGGTCACCAGCGACCGGCCGGTGGCCGCGCTG
CCCGGTGTGCCGACCCTGAAGGCGTCCGGTATCGACCTGGTGTTCCACAACTGGCGGGGG
ATCGTCGCCCCGCCAGGCATCAGTCCCGAGGACCGCAAGCGCTGGATCCGGGCGCTGACC
GCGCTGCACTCCTCGCGGCAGTGGAAGGCCGAGCTCATCCGGCACGGCTGGACCGACGCC
TTCATCACCGGCGGCGCCTTCGGCGCCTATCTCAAGCGGCAGGACGCCGCGGTGGCTGAC
CTGGCCGCACGCCTCGGACTCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005064 Bordetella uptake gene (Family)
 [52-281]  3.3e-28 PF03401
PF03401   TctC
SignalP
 [1-25]  0.998 Signal
Bacteria, Gram-negative   
 [1-32]  1 Signal
Bacteria, Gram-positive   
 [1-25]  0.999 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1